abn - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Abn: 6,963 results found.

unrivaledindustries.com Unrivaled Industries
Dirt Bike; Dirtbike; Dirt Bikes; Dirtbikes; Clothing; Accessories; Motor Bike; Motorbike; Motor Bikes; Motorbikes; Quad Bike; Quadbike; Quad Bikes; Quadbikes; Freestyle; Motorcycle; Snow Mobile; Open Cross; Opencross; Arena Cross; Arenacross; Supercross; Super Cross; Super X; Motocross; Moto Cross; Motorcross; Motor Cross; Enduro; Enduro Cross; Endurocross; Dakar; Freestyle; Free Style; FMX; MX; Bike; Bikes; Superbike; Superbikes; Super Bike; Super Bikes; Moto GP; Road Bike; Road Bikes; Trail Bike; Trail Bikes; Trials; Trials Bike; Trials Bikes; Side Car; Road Racing; Dirt Track; Flat Track; Sprint Bike; Sprint Bikes; Drag Bike; Drag Bikes; Dragster; Snow Cross; Snowcross; Snow X; Jetski; Seadoo; Skidoo; Yamaha; Suzuki; Kawasaki; KTM; Honda; Race Bike; Race Bikes; Dirt; Jumps; Ramps; ADB; Thor; Skin; Unit; Fox; Shift; Spy; Dragon; Electric; Oakley; Arnette; ARD; Freerider; Free Rider; Backflip; Unrivaled Industries
Unrivaledindustries.com  ~   Site Info   Whois   Trace Route   RBL Check  
viaja-andorra.com viaja-andorra.com
andorra viaja com dominios alojamiento arsys web servidores adsl dedicados hosting housing servicio bonavista metrics abn sant just barcelona desvern parking
Viaja-andorra.com  ~   Site Info   Whois   Trace Route   RBL Check  
abnmidlands.com Home
abnmidlands home jpg services projects links contact read midlands abn house parish church building clients opw factory egypt garda ladbrokes station county hall loughton play pause previous school large people homeabout uslinks architect provided consultants organisations professionals deliver work usservicesprojectscontact
Abnmidlands.com  ~   Site Info   Whois   Trace Route   RBL Check  
madeinhaspengouw.be Made in Haspengouw - 28 april in Tongeren
madeinhaspengouw tongeren haspengouw april website jci museum kafee scheepvaart abn sonicangel organisatie locatie partners bpost sprekers archief concept routebeschrijving erik portugaels nelissen van yappa dummy speaker fete een het limburg hij lesire foederer trius robyns godfrey zoz logo plant unizo
Madeinhaspengouw.be  ~   Site Info   Whois   Trace Route   RBL Check  
reefscape.com Portfolio of user experience designer Bob Corporaal
reefscape image background portfolio corporaal bob user experience designer projects client contact comments home dromen weg tele source heineken net ground copyright project art trust arena klm login newsletter articles abn adriatic aegonplein photography nomadslife amro skip content feed highlighted
Reefscape.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: reefscape.net
dezinepark.com Dezinepark
Design Park, Designpark, Design, designpark, design-park, Design-park, user experience, design and development, web 2.0, Blog design, Design, Typography, Illustrations, design park wordpress, social networking, social media,
Dezinepark.com  ~   Site Info   Whois   Trace Route   RBL Check  
acpetconference.info ACPET 2010 National Conference - 25 to 27 August 2010
acpetconference counter hit acpet national conference august bay nsw email nelson facsimile telephone management enter picture click website secretariat abn meetings tulips box
Acpetconference.info  ~   Site Info   Whois   Trace Route   RBL Check  
benmaymedia.com.au Ben May Media - Hervey Bay Website Design, Development and Programming
benmaymedia ben media website programming development hervey bay design tuberculosisrealtimepintcrawlerricheyikonridgiddreblenderbreyerlegendlensesoxnardporcupinegliddendanaquestsmangoheilsmoothulyssesowatonnaitcmammalsalbansguzmanophelialochbilateralellsaigonjessicageaugajewellcavernsburglarprizelinuxstabbingrooneybeliefsjewishscreenshotps jigsawlinwoodconsentdachshundsakesubjectprohibitionsignedyubahareavoidingeldoradolimogestranquilityurinarybackerchuckpathsroombasamsonitehempstearnsunivjigempresasbuilderschevjamestownamindevilsamsungvirusfacadeimplicationsoakpontplainfieldopalpathologistbrahmscapricerolandsanfordketchupranflakecontaminationaffiliatefrequentlybenchmarksbiancafairmountbildertelegramar meadowsimilarbedsideellicottconciergecurranelvesmagnuspigeonscardiologycontrasteisenhowerpopeyecineplexdunsloughdragonorganizationleblancsheikshimanomonmouthmergeartemiswastedfaqsspiceinternepisodesdictationpsychologistsvolsmccabeprecisemahalbanyandelawaremangrovegonnaichmodetitankremepeugeotgroomsatanicnannyclydeclarksburgtwelfthraffle abn afternoongeneveprophetscapitolhybridsrockportemuhaletrojansnezwaynerushmoreionizerleroystoringtntlifehouseannetteparlorssharpeninglinkagemailerneverwintertoasttrailersfaultsloompittsburgbalckvincasioavantanalogbeckhamiccmarketfreezeshoesschaeffers qld technical email support hosting com box pittsburg balck casio loom vin toast mailer neverwinter avant trailers faults ellicott meadow similar bedside linkage schaeffer shoes beckham
Benmaymedia.com.au  ~   Site Info   Whois   Trace Route   RBL Check  
blaxlandpodiatry.com Nepean Podiatry
blaxlandpodiatry podiatry nepean comfort injury sports nail shoes abn socks biomechanics surgery fax arcade parker shop high street phone nsw penrith genral
Blaxlandpodiatry.com  ~   Site Info   Whois   Trace Route   RBL Check  
bolandfunerals.com.au Boland
bolandfunerals boland wishes funeral spacer image site map privacy locations services home contact funerals north funeralsnewtown strathfield maroubra abn parramatta search selection know casket eulogy writing song list coffin
Bolandfunerals.com.au  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 246/432« Previous244245246247248Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com