absolute - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Absolute: 34,867 results found.

absolutechoicecontracting.com Absolute Choice Contracting
Absolute Choice Contracting - Wind, Fire, and Hail damage repair and restoration. Home remodeling in Carmel, Westfield, Fishers, and Indianapolis Indiana.
Absolutechoicecontracting.com  ~   Site Info   Whois   Trace Route   RBL Check  
absolute-link.co.il קידום אתרים מקצועי | קידום אתרים בגוגל | קידום אתר בגוגל | קידום אתרים גוגל | Absolute link
אבסולוט לינק מספקת שרותי קידום אתרים בגוגל בעזרת קידום אתרים מקצועי ואמין העושה שימוש בכל המדיות והאמצעים בעולם האינטרנט על מנת להביא לשיפור בתוצאות העסקיות של אתרך. צרו קשר מיידי ב 052-88-234-25
Absolute-link.co.il  ~   Site Info   Whois   Trace Route   RBL Check  
absolute-magic.com Everything for crystal rhinestones,hotfix rhinestones, rhinestuds, diamante, pearl domes, nailheads, caviar beads, sequins and more.
Diamante Diamante supply everything for heat-applied hotfix crystal rhinestone decoration of all textiles and other items.
Absolute-magic.com  ~   Site Info   Whois   Trace Route   RBL Check  
okelleysfiresafechimneyservice.com Chimney Service Redding, CA - Absolute Chimney Cleaning
Absolute Chimney Cleaning provides Chimney Service, Senior discounts to Redding, CA. Call 530-921-4237.
Okelleysfiresafechimneyservice.com  ~   Site Info   Whois   Trace Route   RBL Check  
abshcohio.com Care Services Vandalia, OH - Absolute Home Care
Absolute Home Care provides caring, compassionate in-home service to Vandalia, OH. Call 937-387-0021 for more information.
Abshcohio.com  ~   Site Info   Whois   Trace Route   RBL Check  
absolute-media.de absolute media - Die Werbeagentur in Siegen - Internet, Werbung, Marketing und Kommunikation
Die Fullservice-Werbeagentur in Siegen für Internet, Marketing und Kommunikation.
Absolute-media.de  ~   Site Info   Whois   Trace Route   RBL Check  
absoluteherbalhealth.com Absolute Herbal Health
Absolute Herbal Health offers herbal products for the promotion of optimal health
Absoluteherbalhealth.com  ~   Site Info   Whois   Trace Route   RBL Check  
absolutehomerenovations.com Home Renovators Hanceville, AL - Absolute Home Renovations
Absolute Home Renovations provides quality renovation services to Hanceville, AL. Call 256-841-0343 for Free Estimates.
Absolutehomerenovations.com  ~   Site Info   Whois   Trace Route   RBL Check  
bostonabsolutemassage.com Absolute Massage - Home
         "Boston's best Massage therapy..." Massage Downtown Boston   
Bostonabsolutemassage.com  ~   Site Info   Whois   Trace Route   RBL Check  
absolutesalesandservices.com Absolute Sales & Services - Home             
Welcome to Absolute Sales & Services
Absolutesalesandservices.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 57/506« Previous5556575859Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com