accident - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Accident: 94,049 results found.

bikerattorney.com Daytona Beach Motorcycle Accident Attorneys, Palm Coast Motorcycle Accident Lawyers
Daytona Beach motorcycle accident lawyers, Politis Law Firm, represent accident victims across the greater Daytona Beach, Deland, Deltona, Flagler, Lake Mary, Orlando, Ormond Beach, Palm Coast, and Port Orange, Florida area. Florida motorcycle accident lawyers represent victims seeking compensation for personal injury, property damage and lost wages due to the negligence of others resulting in a Daytona Beach or Palm Coast motorcycle accident.
Bikerattorney.com  ~   Site Info   Whois   Trace Route   RBL Check  
oklahomacitycaraccidentinjury.com Oklahoma City Car and Truck Accident Lawyer | Motorcycle Accident Attorney in Oklahoma City
Contact an Oklahoma City car accident attorney at our firm if you were injured in a car, truck or motorcycle accident in the Oklahoma City area.
Oklahomacitycaraccidentinjury.com  ~   Site Info   Whois   Trace Route   RBL Check  
truckaccidentlawyerpennsylvania.net Truck Accident Lawyer Pennsylvania
A directory listing of truck accident lawyer in Pennsylvania
Truckaccidentlawyerpennsylvania.net  ~   Site Info   Whois   Trace Route   RBL Check  
truckcommercial-attorneysfortheinjured.net Truck-Commercial-Accident-LP.asp
north carolina: charlotte, rock hill, concord, gastonia, hickory, i-77, i-85 and i-485, north carolina trucking accident attorney, tractor-trailer accidents, semi truck wreck, trailer disconnect, rig, truck driver fatigue, dump truck accident, lawyer, attorney law firm, law office, clients, cases, suit, counsel, legal, representation, litigation, lawsuit
Truckcommercial-attorneysfortheinjured.net  ~   Site Info   Whois   Trace Route   RBL Check  
866attylaw.com New York Personal Injury Lawyer - 866-ATTY-LAW
NY Personal Injury Attorneys - Frekhtman and Associates represents victims of personal injury, accident injury and medical malpractice within NYC
866attylaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: lawbronx.com
bestboatingaccidentlawyer.com The Best Resource for Boating Accident Victims | Best Boating Accident Lawyer
A woman was rescued after she went missing for nearly 15 minutes and almost drowned in a San Diego boating accident on Mission Bay on September 14, 2010. If you or a loved one has been injured or killed in a California boat accident, please call the San Diego personal injury attorneys at the Jurewitz Law Group for a free consultation at 888-233-5020.
Bestboatingaccidentlawyer.com  ~   Site Info   Whois   Trace Route   RBL Check  
metromotorclaims.co.uk Road Traffic Accident & Motorbike Accident Specialists | Metro Motor Claims
Metro Motor Claims specialise in claims for road traffic accidents (RTA), motorbike accidents, personal injuries, slips, trips or falls and more.
Metromotorclaims.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
prescottcaraccidentlawyer.com Prescott Car Accident Attorney | Car Accident Lawyer in Prescott
Have you been injured in a car accident? Contact a Prescott Car Accident Attorney from our firm, we will be able to evaluate your injury case and fight vigorously for your right to fair compensation.
Prescottcaraccidentlawyer.com  ~   Site Info   Whois   Trace Route   RBL Check  
travel-accident-insurance.biz EZ Travel Accident Insurance
We provide the best insurance providers for your travel insurance needs. Each insurer is put through a thorough test of speed, cost and efficiency and we present the results for you. Find the best for what the travel insurance industry has to offer.
Travel-accident-insurance.biz  ~   Site Info   Whois   Trace Route   RBL Check  
caraccidentattorneymemphis.com Car Accident Attorney Memphis
Our car accident lawyers can negotiate the highest possible settlement in the Memphis area. Don't trust the insurance company to tell you what is a fair settlement - they are looking out for themselves, not for you.
Caraccidentattorneymemphis.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 205/531« Previous203204205206207Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com