ado - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Ado: 4,053 results found.

mafamillezen.com MaFamilleZen
activites enfants, sejours en famille, vacances en famille, guide parents, guide ado, webzine ado, webzine parents, guide parents ado
Mafamillezen.com  ~   Site Info   Whois   Trace Route   RBL Check  
melissameli.com Melissa Meli
melissameli melissa meli mail links march showcase tuesday new year happy midsummer cobweb ado hero night dream running watch sing tonys page home donttellmamanyc com creative gallery range permanent link singer actor contact january problem thanks seth talent don like
Melissameli.com  ~   Site Info   Whois   Trace Route   RBL Check  
ollyfox.com Olly Fox - composer for theatre, film and tv
ollyfox olly theatre film composer fox women music vivienne vyle times life ado troilus therese raquin cressida beware heavenly wizard information photos line education contact home press videos national bbc royal radio globe opera rsc shakespeare acclaimed french classical saunders
Ollyfox.com  ~   Site Info   Whois   Trace Route   RBL Check  
plutopetition.com Sign the Pluto Petition
plutopetition pluto petition sign say ado basketball longer responses view pro knicks selected team scientists planet iau enter astronomers real tell votes voting new islands antillesnew ricoqatarreunionromaniarussiarwandasamoasan islandspolandportugalpuerto yugoslav islandsmartiniquemauritaniamauritiusmayottemexicomicronesiamoldovamonacomongoliamontserratmoroccomozambiquemyanmarnamibianaurunepalnetherlandsnetherlands republic ofmadagascarmalawimalaysiamaldivesmalimaltamarshall guineaparaguayperuphilippinespitcairn marinosao caledonianew islandsnorwayomanpakistanpalaupanamapapua arabiasenegalserbia sarmacedonia mariana koreanorthern
Plutopetition.com  ~   Site Info   Whois   Trace Route   RBL Check  
agdett.com Agde Tennis de Table, Le Cap d'Agde, Agde, Languedoc roussillon, Hérault, France, ping pong, jeune, enfant, ado, adulte.
agdett agde pong jeune ado adulte ping enfant france table tennis cap languedoc roussillon hérault
Agdett.com  ~   Site Info   Whois   Trace Route   RBL Check  
gaesdrapery.com Home
gaesdrapery home website business office free live small microsoft contact ironart map site randalk duralee waverly hunter douglas fabricut ado robert rmcoco allen search drapery window treatments gae specialize want live|create jen information view slide com suppliersrobert rights reserved bymicrosoft
Gaesdrapery.com  ~   Site Info   Whois   Trace Route   RBL Check  
fullscaleproduction.com fullscaleproduction.com
fullscaleproduction com read ado hunt helen solar dec opens years dance youth tell production shakespeare design cheaper hosting irwin root stephen services tom photo dubai css ‘nutcracker’ celebrating templates free lovett registry america web domain lyle los pownal sunday angeles
Fullscaleproduction.com  ~   Site Info   Whois   Trace Route   RBL Check  
tiagorocha.com.br Tiago Warst Rocha | Webdesign | WebHosting | LogoDesign |
tiagorocha logodesign webhosting tiago webdesign warst rocha para player bem flash orçamento adobe vindos sites olá msn inicial página dica sua loja migra russo ado pouco mais live photoshop limitado mundo resultado carrinho microsoft conta dislexa compra joomla outros geral
Tiagorocha.com.br  ~   Site Info   Whois   Trace Route   RBL Check  
b8company.com Butterfield 8 Theatre Company
b8company butterfield theatre company marketing contact email reviews history events importance earnest night midsummer dream ado copyright trust design portal website news contra gems understated home costa county sign rossmoor jarrett charles newsletteremail
B8company.com  ~   Site Info   Whois   Trace Route   RBL Check  
benoitonline.com Benoit's Homepage
info, news, cv, curriculum, journaliste, journalisme, dition, rdaction, rdacteur, radio, tlvision, presse, actualit
Benoitonline.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 165/242« Previous163164165166167Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com