afghanistan - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Afghanistan: 15,766 results found.

afghanconflictmonitor.info Afghanistan Conflict Monitor - Human Security Report Project
afghanconflictmonitor security human project report conflict afghanistan monitor pak flag pakistan resources groups forces attacks research taliban daily briefing turkey official office violent incidents peacebuilding issues humanitarian aid rights targeted additional law post read suicide bombings ied researchers figures arms
Afghanconflictmonitor.info  ~   Site Info   Whois   Trace Route   RBL Check  
afghanistanconflictmonitor.com Afghanistan Conflict Monitor - Human Security Report Project
afghanistanconflictmonitor security human project report conflict afghanistan monitor nato flag forces groups resources attacks research daily briefing taliban infiltrators afghan agents rights aid suicide incidents peacebuilding violent ied hunt issues read post spies west targeted researchers additional bombings trains arms
Afghanistanconflictmonitor.com  ~   Site Info   Whois   Trace Route   RBL Check  
ton-out.com Ton Out Photography
delete ton photography +br spain exteriors interiors afghanistan edit num morocco architecture portraits dance fashion page birma remove maroc background new add portfolio contact com javascript piece color custom text mail max black amsterdam optional infothe backgroundno normal type pagenormal
Ton-out.com  ~   Site Info   Whois   Trace Route   RBL Check  
hedayatamin-arsala.com Hedayat Amin-Arsala for President of Afghanistan
arsala hedayatamin amin president manifesto afghanistan hedayat vision dari biography gallery photo improved citizens basic opportunity peaceful sanitation cooperation security economic news government law press production corruption water home media faqs prosperous vocational training regional strengthened relations trade international enhanced
Hedayatamin-arsala.com  ~   Site Info   Whois   Trace Route   RBL Check  
cso.gov.af Central Statistics Organization of Afghanistan - CSO
cso statistics afghanistan organization central ê³æ æµµà ãàèýæµµà ìôíø ì¨íå¹ýæµµà êýâëæµµà µçæ÷éì³ç ìô±¦éì³ç äðèëæµµà å®èëæµµà ore statistical data development workshop meeting labor donors october government gender ministry gathering country ministries different importance national various rebuilding administrative high program kabul held
Cso.gov.af  ~   Site Info   Whois   Trace Route   RBL Check  
hafizjewelry.com Haji Hafizullah Jewelry | Mazare Sharif, Afghanistan
hafizjewelry طلاها afg flag haji afghanistan hafizullah jewelry mazare sharif مشخصات تماس انواع اول خدمات صفحه developed sinnasoft designed rights كاربر نام كلمه رمز copyright received
Hafizjewelry.com  ~   Site Info   Whois   Trace Route   RBL Check  
wowkabul.com Kabul, Kabol, Afghanistan, wowcities.com
wowkabul sign help popup close kabul afghanistan kabol wowcities com page portal loading wow new add group settings cities categoryedit tab layoutedit widget groupedit categorydelete description pages icondelete privilegesadd albummanage organize album connect keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network time
Wowkabul.com  ~   Site Info   Whois   Trace Route   RBL Check  
wowkandahar.com Kandahar, Kandahar, Afghanistan, wowcities.com
wowkandahar sign kandahar help close popup afghanistan wowcities com page portal loading wow new add group settings cities layoutedit tab categoryedit widget groupedit categorydelete description pages icondelete privilegesadd albummanage organize album connect keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network time afrikaansalbanianarabicbelarusianbulgariancatalanchinese
Wowkandahar.com  ~   Site Info   Whois   Trace Route   RBL Check  
obamadashboardpreview.com White House - New Media Dashboard
obamadashboardpreview house white education technology recovery afghanistan iraq health new dashboard media chart sorry need flash
Obamadashboardpreview.com  ~   Site Info   Whois   Trace Route   RBL Check  
ngo-dept.gov.af Islamic Republic of Afghanistan - NGO Department
cistyle home sitemap ngo dept department afghanistan islamic republic ngos international ministry website economy local information development support reporting law reports process organizations registration united activities civil provided society states government projects million links initiative financial implemented different requirements staff
Ngo-dept.gov.af  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 313/552« Previous311312313314315Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com