anesthesia - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Anesthesia: 7,412 results found.

palmbayanimalclinic.com Palm Bay Animal Clinic
Palm Bay Animal Clinic is proud to provide veterinary services such as Vaccinations, Veterinary Dentistry, Microchipping and Surgery to the Indialantic, Melbourne/ Melbourne Beach, Malabar, and Palm Bay communities.
Palmbayanimalclinic.com  ~   Site Info   Whois   Trace Route   RBL Check  
picis.com Picis - Delivering Results in High Acuity (R)
Picis is a global provider of innovative information solutions that enable rapid and sustained delivery of clinical, financial and operational results in the acute care areas of the hospital — the emergency department (ED), operating rooms (ORs), post-anesthesia care units (PACUs) and intensive care units (ICUs).
Picis.com  ~   Site Info   Whois   Trace Route   RBL Check  
pineypointoms.com Oral Surgeons | Houston TX - Piney Point Oral & Maxillofacial Surgery
Houston TX Oral and Maxillofacial surgeons Weil and Koo offer a great variety in dental services. Call for an appointment (713) 783-5560
Pineypointoms.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: tmweiloms.com
prairieanimalhospital.com Prairie Animal Hospital - Veterinarian In Coeur D\' Alene, ID USA :: Home
Prairie Animal Hospital - Veterinary Clinic in Coeur d\' Alene, ID Welcome to Prairie Animal Hospital, your veterinarian in Coeurd'Alene. Call us today at 208-772-3214 ! The doctors at Prairie Animal Hospital are one of the best veterinarians in the Coeurd'Alene area and are committed to your pet's...
Prairieanimalhospital.com  ~   Site Info   Whois   Trace Route   RBL Check  
prestonwoodanimalclinic.com Prestonwood Animal Clinic
Prestonwood Animal Clinic
Prestonwoodanimalclinic.com  ~   Site Info   Whois   Trace Route   RBL Check  
priory.com Priory Medical Journals Online
Medical journals, dental, psychiatric and veterinary journals from Priory Lodge Education Ltd
Priory.com  ~   Site Info   Whois   Trace Route   RBL Check  
rsfvets.com Rancho Santa Fe Veterinary Hospital of San Diego
Rancho Santa Fe Veterinary Hospital is a general practice veterinary care facility for all pets, including dogs, cats, and exotics such as rabbits, birds, and reptiles. Our three veterinarians will provide compassionate, high-quality care for your pet, should your pet require a spay, neuter, vaccine, treatment for an illness, dental care, or a wellness visit.
Rsfvets.com  ~   Site Info   Whois   Trace Route   RBL Check  
saltlakecitymedicalmalpracticefirm.com Salt Lake City Medical Malpractice Attorney | Medical Malpractice Lawyer in Salt Lake City
A Salt Lake City Medical Malpractice Attorney from our legal team provides clients with experienced and dedicated legal representation in medical malpractice cases of all types.
Saltlakecitymedicalmalpracticefirm.com  ~   Site Info   Whois   Trace Route   RBL Check  
strapparatus.com HomeSimple Product Solutions for CPAP complications
headgear for nasal and oro-nasal masks, anesthesia masks, nasal bridge skin barrier,cannula padding for oxygen therapy, endotracheal tube holder,naso-gastric tube leak minimizing device.
Strapparatus.com  ~   Site Info   Whois   Trace Route   RBL Check  
surgicalresearch.org Academy of Surgical Research
Academy of Surgical Research
Surgicalresearch.org  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 178/454« Previous176177178179180Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com