aviv - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Aviv: 4,866 results found.

samwoolfman.com Sam Woolfman | Audiobook, thriller, Podcast
thriller, audiobook of thriller, juval aviv, sam woolfman, audiobook, adventure stories, mossad, espionage
Samwoolfman.com  ~   Site Info   Whois   Trace Route   RBL Check  
dravivouanounou.com Dr. Aviv Ouanounou & Associates
dentist, toronto, on, ontario, ouanounou, cosmetic, veneers, bonding, inlays, whitening, cleaning, stain, crowns, root canals, extractions, bridges, dentures, implants
Dravivouanounou.com  ~   Site Info   Whois   Trace Route   RBL Check  
telavivstay.com Tel Aviv Stay
telavivstay tel aviv stay view calendar apartments accommodation overview terms book conditions mikustudios com rates availability map reservations search photos just fully heart high internet speed bonuses far feature hotel come enjoy designed reserved benefits developed hosting rights copyright television
Telavivstay.com  ~   Site Info   Whois   Trace Route   RBL Check  
omer-aviv.com עומר אביב פרויקטים ובקרה בע"מ
מדריך עסקים omer aviv פרויקטים ובקרה מערכות עומר אביב מוצרים תקשורת החברה בקרה צור גילוי קשר english אודות הבית רחב שירות וביטחון ותיקונים וכיבוי כריזה מעבדת פיתוח רקע ומוזיקת חומרה אתרים לעסקים בניית דוגמא ותוכנה מוצרי פריצה תרגול טלוויזיות במעגל
Omer-aviv.com  ~   Site Info   Whois   Trace Route   RBL Check  
telavivartdesign.com Tel Aviv Art and Design
telavivartdesign art design aviv tel israel uncategorized comments international posts view exhibition architecture installation sculpture posted filled conceptual comment industrial gallery studio photography paper education january graphism bezalel contemporary magazine born space installations new chair experiment light filed ceramics march
Telavivartdesign.com  ~   Site Info   Whois   Trace Route   RBL Check  
momotlv.com MobileMonday Tel Aviv
momotlv mobilemonday aviv tel edit team event post link permanent mobile facebook awards peer atom november comments mwc april february september special monday group france posts orange telecom ringbow wins fring july page january older paypal david august register newsgeek
Momotlv.com  ~   Site Info   Whois   Trace Route   RBL Check  
wowtelaviv.com Tel Aviv, Tel Aviv, Israel, wowcities.com
wowtelaviv sign help tel aviv popup close israel wowcities com page portal loading wow new add group settings cities categoryedit layoutedit tab widget groupedit categorydelete description pages icondelete privilegesadd albummanage organize album connect keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network time
Wowtelaviv.com  ~   Site Info   Whois   Trace Route   RBL Check  
cometotelaviv.com Come To Tel Aviv - Overview
cometotelaviv overview aviv tel come reservation accomodation photos rates studio street peaceful downtown home walking rental distance spectacular com telavivstudio offers apartment long short term
Cometotelaviv.com  ~   Site Info   Whois   Trace Route   RBL Check  
aviv-ocif.com You are not authorized to view this page
aviv ocif support services product microsoft page view authorized iis web http try information search error credentials server directory open using words title supplied browser personnel help perform manager authentication custom messages permission security titled technical inetmgr topics accessible sending
Aviv-ocif.com  ~   Site Info   Whois   Trace Route   RBL Check  
icrtelaviv.org Institutul Cultural Roman Tel Aviv
icrtelaviv aviv tel institutul roman cultural text box
Icrtelaviv.org  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 185/301« Previous183184185186187Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com