buns - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Buns: 2,696 results found.

cowdrys.co.uk Wholesale Bakers for Dorset & Hampshire - Cowdrys Family Bakery
Wholesale bakery in Dorset - Cowdrys is a quality wholesale family bakery serving Dorset, Hampshire and Wiltshire
Cowdrys.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
ihatevegatables.com Home - I hate vegetables.
A WebsiteBuilder Website
Ihatevegatables.com  ~   Site Info   Whois   Trace Route   RBL Check  
marcottiespizzeria.com Pizza Linwood, MI - Marcottie's Pizzaria 989-697-3797
Call now for more information. Marcottie's Pizzaria provides homemade pizza, deli subs, and best calzones to the Linwood, MI area. Call 989-697-3797.
Marcottiespizzeria.com  ~   Site Info   Whois   Trace Route   RBL Check  
mitchperlissfitnessdvdmarketing.com Home
Exercise DVD and Fitness DVD sales, marketing and distribution.
Mitchperlissfitnessdvdmarketing.com  ~   Site Info   Whois   Trace Route   RBL Check  
nurseryrhymes.co.in Nursery Rhymes
useful website for Nursery Rhymes.
Nurseryrhymes.co.in  ~   Site Info   Whois   Trace Route   RBL Check  
rueviet.com RUE VIET
Rue Viet is a vietnamese sandwich and noodle bar located in Jersey City, NJ. Asian flavors and meals such as Banh Mi, Pho, Pork Buns, Noodle Curry, Pork Belly, and more.
Rueviet.com  ~   Site Info   Whois   Trace Route   RBL Check  
banjos.com.au Banjo's Tasmanian Bakery Café > Home
Banjo's home page
Banjos.com.au  ~   Site Info   Whois   Trace Route   RBL Check  
cafemimosa.info Home
Welcome to CafeMimosa.info Cafe Mimosa is a french cafe and coffee shop located in Topanga Canyon, CA. Open for breakfast and lunch, we have a complete menu of pastries, expresso drinks, sandwiches, quiche, salads and delicious pastries.
Cafemimosa.info  ~   Site Info   Whois   Trace Route   RBL Check  
dempsters.ca Welcome to Dempster's - Canada's Quality Bread Bakery
Dempster’s Bakery offers a variety of wholesome products, including: breads, bagels, pitas and more. This Site includes information on Dempster’s products and some healthy and delicious recipes.
Dempsters.ca  ~   Site Info   Whois   Trace Route   RBL Check  
edencafekosher.com Home
This is a French restaurant in your city.
Edencafekosher.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 62/131« Previous6061626364Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com