burundi - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Burundi: 1,546 results found.

cecburundi.org The Charismatic Episcopal Church of Burundi
cecburundi church charismatic burundi episcopal flickr youtube facebook identity cest cec fully worship communion iccec able called bishop congregations convergence seeking home christ diocese jesus lord sacramental evangelical liturgical international welcome bishops movement universal ministries website east link ways bates
Cecburundi.org  ~   Site Info   Whois   Trace Route   RBL Check  
activenturesafrica.com Activenture Safaris - Tours in Uganda, Rwanda & Burundi
activenturesafrica uganda safaris rwanda tours burundi activenture white rafting water day gorilla days mountain tour travel bwindi safari gorillas national akagera kibale services park kenya home adventure qenp tanzania information contact tips lake elizabeth nile forest queen africa chimpanzee attractions
Activenturesafrica.com  ~   Site Info   Whois   Trace Route   RBL Check  
cecrwanda.org The Charismatic Episcopal Church of Burundi
cecrwanda church charismatic episcopal burundi flickr facebook cest youtube identity rwanda worship fully communion iccec cec called diocese bishops convergence welcome bishop sacramental evangelical liturgical able christ jesus lord congregations ngirumpatse seeking bates international east movement home universal com ways
Cecrwanda.org  ~   Site Info   Whois   Trace Route   RBL Check  
wowbujumbura.com Bujumbura, Bujumbura, Burundi, wowcities.com
wowbujumbura sign bujumbura help close popup burundi wowcities com page portal loading wow new add group settings cities layoutedit tab categoryedit widget groupedit categorydelete description pages icondelete privilegesadd albummanage organize album connect keyworddelete share hover shopping traditionalcroatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish network time afrikaansalbanianarabicbelarusianbulgariancatalanchinese
Wowbujumbura.com  ~   Site Info   Whois   Trace Route   RBL Check  
spidernet-bi.com SPIDERNET INTERNET SANS FIL BURUNDI
spidernet gallerie contact services photos internet sans burundi fil bi service une connexion vitesse par notre tres offrir dans jusqu sur tout kbps permanente prêt toujours téléphone hertzienne liaison comprend réservés droits voie haute répondre attentes éme clients com info
Spidernet-bi.com  ~   Site Info   Whois   Trace Route   RBL Check  
eugrass.info exaQt
eugrass exaqt hydrologie burundi budget hydrologique articles wordpress gtz régions projets programme proseceau régionale août les tous dans voir atahualpa commentaires rss org tutorials connexion theme support origine bytesforall clos une tags des hackadelic est pages catégorie pour classés syndication
Eugrass.info  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: eugrass.net - eugrass.org
exaqt.de exaQt
exaqt hydrologie burundi hydrologique budget articles wordpress gtz projets proseceau régions programme régionale août les tous voir dans atahualpa commentaires rss theme org bytesforall tutorials origine connexion support une hackadelic pages clos des tags catégorie est pour syndication classés topic
Exaqt.de  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: exaqt.info
africanmixtapes.com African Mixtapes
africanmixtapes mixtapes african contact feed rss team mixtape burundi bai democracy nunde home skip content com nomadicwax posts view filed rsd comments navigation
Africanmixtapes.com  ~   Site Info   Whois   Trace Route   RBL Check  
burundirelief.org :::::::::: BURUNDI AFRICA ORPHAN RELIEF PROJECT ::::::::::
burundirelief burundi project relief africa orphan site viewing flash player required
Burundirelief.org  ~   Site Info   Whois   Trace Route   RBL Check  
doradohotel.net Dorado Hotel Burundi: Accomodation, Bar services, Restaurant Sservices, budget accomodation in Burundi
doradohotel bar burundi accomodation dorado restauration reservations ligne contacts hebergement gallerie accueil hotel services restaurant sservices budget est ville hôtel bujumbura dans avec des faire centre pour moment affaire nous huit avons dix hébergement nouveaux remis matériels récemment approprié équipé
Doradohotel.net  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 64/96« Previous6263646566Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com