cape - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Cape: 76,192 results found.

capebretonliving.com Cape Breton Living Splash
Cape breton Living is the home page of Cecile Samson about Cape Breton Island with a webcam, links, paintings, drawings, photos, stories, arts, maps and variety
Capebretonliving.com  ~   Site Info   Whois   Trace Route   RBL Check  
capecrusaders.com Cape Cod Business Directory
Cape Cod, Search Cape Cod Harwich, Hyannis, Falmouth, Cape Cod online website and business directory that uses customer feedback to establish ratings on local businesses.
Capecrusaders.com  ~   Site Info   Whois   Trace Route   RBL Check  
destinationrsa.com Listing Of Accommodation In South Africa, Apartments & Guest Houses SA
Complete Listing Of South African Accommodation, Self-serviced Apartment Accommodation, Holiday Guest Houses In South Africa, Listing Of Bed & Breakfast Hotels, Luxury Waterfront Holiday Homes & More.
Destinationrsa.com  ~   Site Info   Whois   Trace Route   RBL Check  
erinsellscapecod.com Cape Cod Real Estate
Cape Cod Real Estate, Cape Cod Summer Homes, Cape Cod Beach Homes, Cape Cod property for sale, Cape Cod vacation homes, beach homes, waterfront homes, cottages, salt boxes, Capes, condos, ranches and more. Search land, homes and commercial property located on Cape Cod.
Erinsellscapecod.com  ~   Site Info   Whois   Trace Route   RBL Check  
kevinwilliamslandscapedesign.com Lawn Cape Girardeau, MO - Williams Landscape Design 573-587-1714
Williams Landscape Design provides Commercial and residential, Landscape installation, Landscape maintenance to Cape Girardeau, MO. Call 573-587-1714
Kevinwilliamslandscapedesign.com  ~   Site Info   Whois   Trace Route   RBL Check  
masonryconstructionandrestoration.com Masonry Construction and Restoration: Cape Cod MA
Charles Dowick, Masonry Construction and Restoration has been providing quality masonry services to all their clients since 1984. Brick and stone design, build and remodeling services. Cape Cod, South Shore & Metro West
Masonryconstructionandrestoration.com  ~   Site Info   Whois   Trace Route   RBL Check  
nerentals.com New England Rentals & Vacations - Cape Cod and Maine vacation rentals, summer homes seasonal vacation rentals in Maine & Cape Cod Mass.
Maine and Cape Cod vacation rentals, waterview rentals and Maine mountain area summer and seasonal rental homes on Cape Cod.
Nerentals.com  ~   Site Info   Whois   Trace Route   RBL Check  
caboverdeproperty.com Cape Verde Property | Cabo Verde Properties | Kapverden Immobilien | Immobili
The property portal for Cape Verde - Das Immobilien Portal der Kapverden - Il portale di immobili di Capo Verde - El portal inmobiliario de Cabo Verde
Caboverdeproperty.com  ~   Site Info   Whois   Trace Route   RBL Check  
capecoralelectrician.com Cape Coral Electrician
These qualified electricians will then contact you to compete for your business.
Capecoralelectrician.com  ~   Site Info   Whois   Trace Route   RBL Check  
capemotorsinc.com Cape Motors Inc. - Quality Pre-owned Vehicles at Affordable Prices. Browse our Online Inventory. Hyannis, MA
Cape Motors Inc., used cars cape cod, used trucks, used SUV, used vans, used minivans, used cars hyannis
Capemotorsinc.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: capemotors.net
 


Page 235/597« Previous233234235236237Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com