casual - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Casual: 51,890 results found.

fbclakesidecity.org First Baptist Church Lakeside City
Baptist, Church, God, Jesus, Salvation, Southern Baptist, First Baptist, Christian, Lord, Lord God, Almighty God
Fbclakesidecity.org  ~   Site Info   Whois   Trace Route   RBL Check  
fragnacnac.com Fragnacnac Casual Apparel & Accessories - Make It Up As You Go!
fragnacnac make accessories apparel casual group free gift check account shopping bag design rohd faqs use website map site terms privacy security sales orders facebook twitter kidz ground shipping extraz headz womenz menz join register updates email sign destinations believe
Fragnacnac.com  ~   Site Info   Whois   Trace Route   RBL Check  
greenoliveco.com oo   Green Olive Catering   oo
greenoliveco green olive catering elegant casual menus home contact function staff facilities sample testimonials company reserved rights copyrighted material guides event attention complete original visions broad feel confident team perfect creative talented element place party
Greenoliveco.com  ~   Site Info   Whois   Trace Route   RBL Check  
keinz.net Keinz Clothing - Snowboard Gear, Casual, Extreme
keinz sponsors tahoepcguy photos click pics site net info extreme gear clothing snowboard casual
Keinz.net  ~   Site Info   Whois   Trace Route   RBL Check  
kitschenscatering.com Kitschens Catering: New Jersey Casual Dining
kitschenscatering info gallery links menu contact kitschens catering casual dining new jersey restaurant week join facebook occasions cuisine offering elegance creative simple presented logo lounge mailing list langosta
Kitschenscatering.com  ~   Site Info   Whois   Trace Route   RBL Check  
labradorlounge.com Labrador Lounge: Casual Jersey Shore Dining
labradorlounge kitschens lounge labrador shore casual dining jersey gallery links contact menu press info events calendar join week restaurant facebook vacation beach normandy logo list black mailing purchase buy locations check opened laid sea cuisine offers hot spot atmosphere yearlong
Labradorlounge.com  ~   Site Info   Whois   Trace Route   RBL Check  
laurielangdon.com Home
laurielangdon home css laurie volny langdon casual links photo gallery contact audio visual new dance captain production broadway working phantom weeks york life position road touring great opera city best previous dynamic people theater majestic previously solo dancer group pleasures
Laurielangdon.com  ~   Site Info   Whois   Trace Route   RBL Check  
lordsofelune.com Lords of Elune Home
lordsofelune home lords elune guild prevail info agamaggan casual cataclysm raiding application raid forums
Lordsofelune.com  ~   Site Info   Whois   Trace Route   RBL Check  
macondonyc.com Welcome to Macondo NYC - Casual Latino Eatery
macondonyc latino macondo welcome nyc eatery casual latin street sat houston twitter mexico features brazilian tacos follow churros chocolate spain barcelona juice visit sister restaurant fan cocas extracts bar freshly squeezed facebook menu everyday fri open til hours york location
Macondonyc.com  ~   Site Info   Whois   Trace Route   RBL Check  
metajeans.com meta jeans, your online casual shop!
metajeans meta shop casual online jeans που σήματα φέρουν εταιριών κατασκευαζουν rayscalculatingmcgeehingesorwellstokebendixsandpointcrowhandicapfirearmekghackedenemiesgqenlargefrazerfreezingturretkendallproswrestlesawmillbeachesroseburgreversalhayleytournementinstrumentriflesdadroboticsvineyardsstuckpensionlandmarksracingholdemhowtobursafolsomnikkorspectroscopyparaderiverwalklilaelkhartambrosiamigrate lecturesalisonwowomronknottguyheaderappletonmessaginghoyleculinarymonarchbarbraassistmutualadventuresuscgoakwoodcarletontazlycratrailerswigginsaauvaldeznephewpapcomputationvalidpowerscloseoutunoshiawwpulllendingswtradewindsdoolittlecursivelahoredogtalesanalyzelucitereferencesingaporegraphsesteejiuactingliesglobalsinglesyankovicbournewedgemicrocontrollerpumpkinsbyuunleashedprobescorinneserversshadowsoverlaykodiakincreasedcanfieldpredictivefoxxcomerciolynnpositionsecuredkeenukiahpolicingroachspreadsheetslexmarklinconlinuxjuliusenzymesbeatrixturkdiscreetpracticalitiesfraternaloedipusplatoonsuspectinternationindiaresearchermagslawlerpamcompetitorswickerevansramblereaselpunisheralgonquintatstudiozappagelanyardsfilteringvladimircarrfungidoddvanitiesanalyzenewburyportmeshlettucekelsoreproducevalenciavouchersdogsacredpenskegoodyeardrinksamericanafixernursesnitricleavenworthvarietycontetastyobesekonicabagscontaminationbootlegpreviewproductionswootengildedeuropemohammedstonymccombx και των είδη όλα αυθεντικά στο πωλούνται μας site είναι analyze dog tasty conte obese konica nurses americana bags fixer nitric leavenworth variety mccomb europe mohammed stony
Metajeans.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 319/372« Previous317318319320321Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com