cerebral - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Cerebral: 6,881 results found.

careforkaiya.com Care For Kaiya
A charitable organization benefiting Kaiya Barbers mission to overcome the effects of cerebral palsy.
Careforkaiya.com  ~   Site Info   Whois   Trace Route   RBL Check  
oliverlawaccidentinjury.com Attorney Livonia, MI ( Michigan ) - Oliver Law Firm
Oliver Law Firm provides legal counsel for personal injury, criminal law and malpractice suits in the Livonia, MI area. 25 yrs exp. Call 248-477-1900.
Oliverlawaccidentinjury.com  ~   Site Info   Whois   Trace Route   RBL Check  
birth-injury-lawyer-new-york.com Birth Injury Lawyer New York , New York Birth Injury Attorneys-New York Birth Injury Attorneys
We are New York number one birth injury lawyers. Our birth injury attorneys will fight for you. Don't hesitate to contact our birth injury lawyers. New York attorneys that work for you.
Birth-injury-lawyer-new-york.com  ~   Site Info   Whois   Trace Route   RBL Check  
bronxmedicalmalpracticelawyersfirm.com Bronx Medical Malpractice Lawyers, Bronx Medical Malpractice Lawyer, Bronx Medical Malpractice Law Firm
Do you need Bronx Medical Malpractice Lawyers? Call 718-522-1743 to speak with, Reibman Weiner today to discuss your case.
Bronxmedicalmalpracticelawyersfirm.com  ~   Site Info   Whois   Trace Route   RBL Check  
brooklynmedicalmalpracticelawyersfirm.com Brooklyn Medical Malpractice Lawyers, Brooklyn Medical Malpractice Lawyer, Brooklyn Medical Malpractice Law Firm
Are you looking for Brooklyn Medical Malpractice Lawyers? Call 718-522-1743 to speak with, Reibman Weiner today to discuss your case.
Brooklynmedicalmalpracticelawyersfirm.com  ~   Site Info   Whois   Trace Route   RBL Check  
enablecny.org Individualized services for children & adults with disabilities in Syracuse & Central New York - Enable
Enable: Individualized services for children & adults with disabilities in Syracuse & Central New York
Enablecny.org  ~   Site Info   Whois   Trace Route   RBL Check  
1-800-4mybaby.info 4MyBaby - Blog Home
4MyBaby Resources - Information to help you and your child in coping with Cerebral Palsy
1-800-4mybaby.info  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: 1-800-4mybaby.net - 1-800-4mybaby.org - 4mybaby.org - formybaby.info - formybaby.net
myadvocatesblog.com My Advocates Blog
Experienced lawyers advocating for your legal rights and a medical team lead by a board-certified physician
Myadvocatesblog.com  ~   Site Info   Whois   Trace Route   RBL Check  
prjohnny.com what was I thinking?
ramblings from a cerebral storage locker...
Prjohnny.com  ~   Site Info   Whois   Trace Route   RBL Check  
clinica-neuros.com Tratamientos de neurocirugía en Valencia - Neurocirujano Dr. Vicente Vanaclocha
Clínica Neuros
Clinica-neuros.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 51/307« Previous4950515253Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com