counselors - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Counselors: 16,003 results found.

bsatroop525.net BSA Troop 525
Boy Scout Troop 525 Tracy,Ca
Bsatroop525.net  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: bsatroop525.org
barkatslaw.com Washington Administrative and General Government Work Attorneys | District of Columbia Aircraft and Aerospace, Banking and Financial Lawyers, Law Firm - Barkats %26 Associates, Chartered Attorneys and Counselors At Law
Washington Administrative and General Government Work Attorneys of Barkats & Associates, Chartered
Attorneys and Counselors At Law pursue cases of Administrative and General Government Work, Aircraft and Aerospace, and Banking and Financial in Washington District of Columbia.

Barkatslaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
ccsninc.com Hopewell Counseling: Home
Hopewell Counseling provides professional christian counseling that is Biblically based and psychologically sound to the greater Jackson Mississippi area.
Ccsninc.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: hopewellonline.com
riversidecounseling.net Welcome to Riverside Counseling Center - Distinctive Quality in Behavioral Healthcare
Riverside Counseling Center is first-class group practice of psychiatrists, psychologists, and counselors; providing marital, and individual therapy to Leesburg, Sterling, and Ashburn area.
Riversidecounseling.net  ~   Site Info   Whois   Trace Route   RBL Check  
dealbug.biz DealBug
This DealBug IS a laughing matter! Today you get 4 floor seats AND 2 Appetizers at Stanford's Comedy Club for only $19 - more than a $108 dollar value! Stanford's has the finest comedy facility in America located at The Legends. With two theatre levels, booth-like and movie theatre seating, plus tables, there is not a bad seat in the house. Need plans for the weekend? Not with this voucher - we've got your plans covered! Upcoming acts include Jimmy "JJ" Walker, Pat Dixon and Bret Ernst. Buy this deal now to get in on the fun!
Dealbug.biz  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: dealbug.com - dealbug.info - dealbug.mobi - dealbug.net - dealbug.org
donnellyllp.com Donnelly LLP. Attorneys and Counselors at Law in Washington, D.C. and Bokeelia, Florida.
A business services and wealth preservation law firm in Washington, D.C. and Bokeelia, Florida. Serving clients in Washington, D.C., Virginia, Florida, and Indiana since 1971.
Donnellyllp.com  ~   Site Info   Whois   Trace Route   RBL Check  
getdealbug.com DealBug
It's been a long day at work and walking up to the front door of your house, all you want to do is sit and relax. As you put your key in the door, you remember the barely contained chaos of the home you left this morning and just thinking about it makes you want to sit on your stoop with your back to the door. Sigh... Or you want to get on top of some spring cleaning around your home and start the season out right. But between juggling your work schedule, your spouse's work schedule, and the rotating school-practice-social life of your kids, you decide you'll just have to put it off until summer. Or maybe you'll get around to it in August... With today's deal, you won't have to face down the clutter in your home at the end of the day, or put off that Spring sweep til the snow starts to fall. Heavenly Home Cleaning is offering $75 worth of home cleaning services for just $29. Test the waters of having a professional fight the battle of keeping your space livable, and you may never go back. Or use their services right before a holiday family visit or a special dinner party and be able to enjoy the anticipation of seeing your loved ones and friends...instead of the anxiety of an all-day scramble to get your home looking like the Heavenly Home Cleaning crew can provide with just one call.
Getdealbug.com  ~   Site Info   Whois   Trace Route   RBL Check  
mewpeers.org Welcome to A More Excellent Way
A More Excellent Way
Mewpeers.org  ~   Site Info   Whois   Trace Route   RBL Check  
privatepracticefinancesmadeeasy.com Therapists Private Practice Finances – Counselors Finances – Alternative Health Practitioner business finances
Private Practice Finances Made Easy is a program to help counselors, therapists and alternative health professionals get their business finances organized and create a plan for increasing their income.
Privatepracticefinancesmadeeasy.com  ~   Site Info   Whois   Trace Route   RBL Check  
ritterandrandolph.com Ritter and Randolph, LLC, Attorneys and Counselors at Law, Cincinnati, Ohio
Ritter & Randolph, LLC is a full service law firm that delivers personal service, practical advice, good value and creative solutions to bring results. Our attorneys are licensed to practice in Ohio, Kentucky, Indiana and Virginia. We have been in business for over 65 years. We operate with a dedicated team of experienced attorneys and professional staff whose main focus is serving our clients’ needs.
Ritterandrandolph.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 98/498« Previous96979899100Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com