custody - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Custody: 31,022 results found.

seattledivorcefirm.com Seattle Divorce Lawyer | Seattle Family Law Attorney
If you are considering a divorce, a family law attorney from our Seattle law firm can assist you with all aspects of your case, and will reduce a great amount of your stress during this time. 
Seattledivorcefirm.com  ~   Site Info   Whois   Trace Route   RBL Check  
tarahatcherlaw.com Midlothian Child Abuse and Neglect Attorneys | Virginia Child Custody, Child Support Lawyers, Law Firm - Tara D. Hatcher Law Firm, PLC
Midlothian Child Abuse and Neglect Attorneys of Tara D. Hatcher Law Firm, PLC pursue cases of Child Abuse and Neglect, Child Custody, and Child Support in Midlothian Virginia.
Tarahatcherlaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
warrenwelchesq.com Rochester NY Family Law Attorney | New York Divorce & Child Support Lawyer | Monroe County Legal Separation Attorney
For 40 years, Rochester, New York family law attorney Warren Welch has handled divorce, child custody and more. Call 866-488-7260 to schedule your consultation.
Warrenwelchesq.com  ~   Site Info   Whois   Trace Route   RBL Check  
atlantianlegal.com WA Paralegal Services in Washington State Family Law Documents
Divorce, Child Support, Custody, Parentage-Paternity, Parenting Plans, Visitation, Modification, online, Washington State, WA, Seattle, Tacoma, Bellevue, Federal Way, Kent, Renton, Auburn, Everett, Vancouver, Lakewood, Shoreline, Redmond, Kirkland, Edmonds, Sammamish, and Marysville, Lynnwood, and Bothell.
Atlantianlegal.com  ~   Site Info   Whois   Trace Route   RBL Check  
brucezivley.com Home
At the Houston family law office of Bruce C. Zivley, Attorney at Law, I put over 25 years of experience to use in helping clients solve their divorce and child custody problems.
Brucezivley.com  ~   Site Info   Whois   Trace Route   RBL Check  
clementlawcenter.com Home
Clement Law Center, in Federal Way, Washington, offers a full range of legal services including, family law, criminal law and personal injury. Call to speak with an attorney.
Clementlawcenter.com  ~   Site Info   Whois   Trace Route   RBL Check  
dallasdivorceattorneyadvice.com Dallas Divorce Attorney | Legal Assistance
Dallas Divorce Attorney Teresa Clark Evans Represents Clients in the Dallas Region
Dallasdivorceattorneyadvice.com  ~   Site Info   Whois   Trace Route   RBL Check  
daughertylawpc.com Manassas Criminal Defense Lawyers, Virginia Divorce & Child Custody Law Firms - Daugherty Law Firm
Manassas attorneys at the Daugherty Law Firm concentrate in their practice in the areas of criminal law, family law, personal injury and wrongful death.
Daughertylawpc.com  ~   Site Info   Whois   Trace Route   RBL Check  
divorceattorneyandfamilylawfayetteville.com Contact Our Divorce Lawyers in NC | Hedahl & Radtke Family Law Center - Local Search - LocalEdge.com
Hedahl & Radtke Family Law Center provides Fayetteville, NC with child custody lawyers, divorce lawyers, and family law lawyers. Call us at 910-323-5430.
Divorceattorneyandfamilylawfayetteville.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: hedahlandradtke4u.com
familylawcleveland.com Family Law Cleveland - Phillips, Mille & Costabile Co., L.P.A.
At Phillips, Mille & Costabile Co., L.P.A., we combine decades of legal experience with a caring, practical approach to divorce, child custody dispute, need to change or enforce child support or other domestic matter.
Familylawcleveland.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 315/575« Previous313314315316317Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com