damages - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Damages: 12,760 results found.

kilanifender.com Home - Kilani Fender - Auto collision repair shop
Collision auto repair shop. Insurance repairs. All insurances accepted. Free estimates. Complimentary loaners available while your car is in the shop. ASE and Icar certified technicians. Quality work with fair rates.
Kilanifender.com  ~   Site Info   Whois   Trace Route   RBL Check  
larryedge.com Home
bankruptcy attorney
Larryedge.com  ~   Site Info   Whois   Trace Route   RBL Check  
libel-lawyer.com Libel Lawyer - Dozier Internet Law Web Specialists
Libel Lawyer: Dozier Internet Law PC is an Internet Libel Lawyer Specializing in Protecting Web Business Reputations
Libel-lawyer.com  ~   Site Info   Whois   Trace Route   RBL Check  
litigationlaw.net The law of Trial Practice and Litigation Techniques
The law of trial practice, litigation techniques, admission of evidence, examination of witnesses, closing argument and more
Litigationlaw.net  ~   Site Info   Whois   Trace Route   RBL Check  
maritimelawlegalguide.com Maritime Law Legal Guide
Maritime Law Legal Guide
Maritimelawlegalguide.com  ~   Site Info   Whois   Trace Route   RBL Check  
montgomerycountywaterdamage.info Houston Water Damage Restoration | Emergency Extraction | Fire, Flood – H2O Solutions
Houston water damage restoration, including emergency water extraction and restoration after water leaks as well as sewage, fire and flood damage clean up is offered. H 2 O Solutions will help you quickly return to your home or business.
Montgomerycountywaterdamage.info  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: montgomerycountywaterdamage.org - restornation.com
morrisllc.com Morris Accouting and Consulting, LLC
Morris Accounting and Consulting, LLC provides more than just accounting, we specialize in business valuations and litigation support.
Morrisllc.com  ~   Site Info   Whois   Trace Route   RBL Check  
mtpilawyers.com Welcome to MTPILawyers.com :: Solomon Neuhardt, Montana Attorney at Law
Solomon Neuhardt, personal injury attorney in Billings Montana and the surrounding areas. Contact Solomon Neuhardt for a free client consultation today!
Mtpilawyers.com  ~   Site Info   Whois   Trace Route   RBL Check  
nashvillemedicalmalpracticelawfirm.com Nashville Medical Malpractice Lawyer | Nashville Medical Malpractice Attorney
Nashville medical malpractice lawyer John Whitfield can help you file a medical malpractice claim to collect damages for your injuries.
Nashvillemedicalmalpracticelawfirm.com  ~   Site Info   Whois   Trace Route   RBL Check  
nc-dwi-help.com The Dummit Law Firm - Your source for DWI defense, criminal law, class actions, and more
Defend yourself from a DWI or DUI charge with the help of The Dummit Law Firm and the DWI and Your Rights DVD.
Nc-dwi-help.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: nc-dwi-online.com
 


Page 150/456« Previous148149150151152Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com