devi - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Devi: 5,017 results found.

vaishnodevidairy.com :: Vaishno Devi Dairy Products Pvt. Ltd. ::
vaishnodevidairy com infodynamicsoftwares vaishno devi dairy pvt products nation women feed economic men designed ensuring maintained site copyright goal food security ensure priority main citizens best sustainable harmonious achieve way manner
Vaishnodevidairy.com  ~   Site Info   Whois   Trace Route   RBL Check  
koottalumoodutemple.org Koottalumoodu ARULMIGU BHADRESWARI DEVIYE NAMAHA
koottalumoodutemple arulmigu bhadreswari koottalumoodu deviye namaha devi resolution view use best continue family bless click
Koottalumoodutemple.org  ~   Site Info   Whois   Trace Route   RBL Check  
gdmieducation.org GINNI DEVI MODI INSTITUTION OF EDUCATION, Modinagar
gdmieducation education modi modinagar ginni devi institution college institute cities different span hailed time girls short need women degree cater upcoming escapable higher engg versions later resolution web master reserved rights viewed best tech president chem establishing litt eco reputed
Gdmieducation.org  ~   Site Info   Whois   Trace Route   RBL Check  
contrastodesign.com Contrasto S.n.c. - Homepage
contrastodesign flash player aggiornare contrasto homepage immagine non vedi devi
Contrastodesign.com  ~   Site Info   Whois   Trace Route   RBL Check  
rdwc.org Welcome to Rama Devi Women's College, Bhubaneswar
orissa govt college, rd, rd women's college, bhubaneswar govt college,
Rdwc.org  ~   Site Info   Whois   Trace Route   RBL Check  
supportogv.com Supporto GV
supportogv supporto password username effettuare entrare devi login
Supportogv.com  ~   Site Info   Whois   Trace Route   RBL Check  
ssdmtc.com Smt. Shanti Devi Management and Technology college
ssdmtc canopies devi smt college shanti technology management admission form click download faculty courses facilities contact home notice board gallery training departments director query education msg photo students trust rewari quality providing strong knowledge india introduction mgt session course exposure
Ssdmtc.com  ~   Site Info   Whois   Trace Route   RBL Check  
smtjaipattidevismarakmahavidyalaya.org Smt. Jaipatti Devi Smarak Mahavidyalaya Pargana Karchana Allahabad
smtjaipattidevismarakmahavidyalaya signup email smt mahavidyalaya devi smarak jaipatti karchana pargana allahabad contact affiliation society rights area tehsil village query infrastructure academics home members staff online established pradesh rural backward people reserved abhishek mishra uttar yogesh saran developed education website comes
Smtjaipattidevismarakmahavidyalaya.org  ~   Site Info   Whois   Trace Route   RBL Check  
rdcecn.org Rukmini Devi Centre of Excellence in Computational Nanotechnology
rdcecn computational nanotechnology rukmini devi centre excellence using methods training workshop openings experimental current hands job spectroscopy organized rdias castep field india calculations advancements research knowledge nanostructures structure empirical method binding tight spds excel investments density better equip attract empower
Rdcecn.org  ~   Site Info   Whois   Trace Route   RBL Check  
mckatra.com Municipal Committee Katra::Gateway to Vaishno Devi Ji
mckatra katra committee municipal devi vaishno gateway information porter home forms download geographical yatries importance map religious max services places glance tenders cultural search holy town jammu located website read contact developed reserved rights maintained year host millions people byg
Mckatra.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 194/302« Previous192193194195196Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com