dfw - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Dfw: 20,697 results found.

mydfwtx.com SOHO Portal - North Texas-DFW's Entrepreneur Resources Portal
North Texas-DFW's Entrepreneur Resources Portal providing tools for Texas Entrepreneurs
Mydfwtx.com  ~   Site Info   Whois   Trace Route   RBL Check  
dfwmetroplexlots.com Northeast Tarrant County Land and Lots for Development - DFW Metroplex Lots
Northeast Tarrant County Land and Lots for Development - DFW Metroplex Lots
Dfwmetroplexlots.com  ~   Site Info   Whois   Trace Route   RBL Check  
playwhatyousay.com Dallas Disc jockey DFW Mobile DJ Clowns Dallas Party
Art of Music DJs is Dallas’ Top Disc Jockey! Completely Mobile our DJs serve all of the DFW area, we also offer other party favorites such as Clowns, Planning Assistants, Photography and Videography
Playwhatyousay.com  ~   Site Info   Whois   Trace Route   RBL Check  
dfwbugs.com Dayton Pest Control - Home
Dayton Pest Control is dedicated to providing high quality service at a reasonable price. Termites, rats, rodents, mice, Plano pest control, Highland Park pest control
Dfwbugs.com  ~   Site Info   Whois   Trace Route   RBL Check  
freeingthenet.com DFW FreeNet - Dallas/Ft Worth's Free Wireless Network
DFWFreeNet is a community built, owned and operated community wireless network in the Dallas / Ft. Worth (North Texas) area. We're committed to building a free wireless network for everyone using volunteers and sponsoring businesses.
Freeingthenet.com  ~   Site Info   Whois   Trace Route   RBL Check  
jobsdfw.com Dallas Jobs, DFW Jobs, Careers & Employment on JobsDFW.com
Dallas Jobs. Looking for top local jobs in Dallas Texas? JobsDFW is DFW's premier internet job source for finding employment in the DFW Metroplex. Search Dallas Jobs in Dallas TX
Jobsdfw.com  ~   Site Info   Whois   Trace Route   RBL Check  
suenelsonart.com Artist Fort Worth - Artist DFW - Artist Dallas
Hi, I'm Sue Nelson, Artist Fort Worth, Artist DFW, Artist Dallas, Texas. I can do large and small artistic work on canvas, paper, or anything, even pottery. I do Oil Paintings, Water Color Paintings, Pencial Sketches and Drawings, Ink Sketches and Drawing, Charcoal Sketches and Drawing, and Acrylic Paintings. My subjects are Portraits, Nature, Landscapes, Religious, Christian, Cowboy, Western, Still Life, Maritime, Wall Murals and Sketches in the Fort Worth Texas area.
Suenelsonart.com  ~   Site Info   Whois   Trace Route   RBL Check  
chimneyandwildlifespecialist.com Dallas Chimney Sweep - DFW Cleaning - Home
Dallas Chimney and Wildlife Specialist offers chimney sweep service, chimney cleaning, chimney caps and wildlife attic removal in Dallas and DFW, including skunks and raccoons.
Chimneyandwildlifespecialist.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: dallaschimneywildlife.com
dfwairporter.net DFW Airporter Car Services - Here to Transport You!
DFW Airporter offers exceptional car services at affordable prices. Our drivers are well-mannered and always on time. Our cars are always clean, and ready! Any where, Any place, DFW Airporter is there!
Dfwairporter.net  ~   Site Info   Whois   Trace Route   RBL Check  
dfwofficebrokers.com                DFW Office Brokers                Tenant Representation - Home
DFW Office Brokers Tenant Representation Dallas, Plano, Richardson
Dfwofficebrokers.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 80/512« Previous7879808182Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com