differences - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Differences: 10,068 results found.

orasicg.com ORASI consulting group - Negotiating Better Results
ORASI Consulting Group Inc. is committed to help people and organizations improve performance and achieve success by building bridges among differences. We are committed to turn challenges into opportunities to create value, growth and development
Orasicg.com  ~   Site Info   Whois   Trace Route   RBL Check  
pedptot.com Rosemary White | Rosemarywhite | Pediatric PT & OT Services
Rosemary White, Rosemarywhite, Pediatric PT OT Services
Pedptot.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: rosemarywhitepediatricservices.com
pictonat.com Photos by Picto-Nat
View creative photos taken by Picto-Nat of night photography, weddings, and more! Enjoy the differences in perspective.
Pictonat.com  ~   Site Info   Whois   Trace Route   RBL Check  
roxanaeslamieh.com Roxana Eslamieh
As I make art, I primarily work with pen and paper, pastel or printmaking. Through these mediums, I
Roxanaeslamieh.com  ~   Site Info   Whois   Trace Route   RBL Check  
simpleidea.co.uk Simple Idea
Simple Idea - web hosting, domain registration, web design, logo design, and business advice. All you need to get your idea started on the internet.
Simpleidea.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
smallstepstohealth.com Small Steps to Health
Never take orders from a cookie!
Smallstepstohealth.com  ~   Site Info   Whois   Trace Route   RBL Check  
smisupplychain.com The Strategic Marketplace Initiative - a forum for health care executives.
The Strategic Marketplace Initiative (SMI) is a consortium of executives representing healthcare providers; medical products, pharmaceuticals and supply chain distribution companies; and service businesses united to reengineer and advance the future of the healthcare supply chain.
Smisupplychain.com  ~   Site Info   Whois   Trace Route   RBL Check  
social-synergy.com Social Synergy
A place where meeting new people are friendships waiting to happen.
Social-synergy.com  ~   Site Info   Whois   Trace Route   RBL Check  
surrealexpatmoments.com Surreal moments in the life of an American expatriate in Europe.
Nicholas Bond, an American observer/student/writer lives abroad and notices many odd little cultural differences.
Surrealexpatmoments.com  ~   Site Info   Whois   Trace Route   RBL Check  
teachuhow.com Bright Learning - Cyber High School | INDEX | Special Needs Education
A Place for your child to grow. Designed by experience leaders in the Central Florida education , our goal is to engage families in the educational process, to suport parents.
Teachuhow.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 132/535« Previous130131132133134Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com