Differences

Differences: 10,068 results found.

ORASI consulting group - Negotiating Better Results
ORASI Consulting Group Inc. is committed to help people and organizations improve performance and achieve success by building bridges among differences. We are committed to turn challenges into opportunities to create value, growth and development
Orasicg.com ~ Site Info Whois Trace Route RBL Check

Rosemary White | Rosemarywhite | Pediatric PT & OT Services
Rosemary White, Rosemarywhite, Pediatric PT OT Services
Pedptot.com ~ Site Info Whois Trace Route RBL Check
Similar Sites: rosemarywhitepediatricservices.com

Photos by Picto-Nat
View creative photos taken by Picto-Nat of night photography, weddings, and more! Enjoy the differences in perspective.
Pictonat.com ~ Site Info Whois Trace Route RBL Check

Roxana Eslamieh
As I make art, I primarily work with pen and paper, pastel or printmaking. Through these mediums, I
Roxanaeslamieh.com ~ Site Info Whois Trace Route RBL Check

Simple Idea
Simple Idea - web hosting, domain registration, web design, logo design, and business advice. All you need to get your idea started on the internet.
Simpleidea.co.uk ~ Site Info Whois Trace Route RBL Check

Small Steps to Health
Never take orders from a cookie!
Smallstepstohealth.com ~ Site Info Whois Trace Route RBL Check

The Strategic Marketplace Initiative - a forum for health care executives.
The Strategic Marketplace Initiative (SMI) is a consortium of executives representing healthcare providers; medical products, pharmaceuticals and supply chain distribution companies; and service businesses united to reengineer and advance the future of the healthcare supply chain.
Smisupplychain.com ~ Site Info Whois Trace Route RBL Check

Social Synergy
A place where meeting new people are friendships waiting to happen.
Social-synergy.com ~ Site Info Whois Trace Route RBL Check

Surreal moments in the life of an American expatriate in Europe.
Nicholas Bond, an American observer/student/writer lives abroad and notices many odd little cultural differences.
Surrealexpatmoments.com ~ Site Info Whois Trace Route RBL Check

Bright Learning - Cyber High School | INDEX | Special Needs Education
A Place for your child to grow. Designed by experience leaders in the Central Florida education , our goal is to engage families in the educational process, to suport parents.
Teachuhow.com ~ Site Info Whois Trace Route RBL Check