disclosure - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Disclosure: 52,206 results found.

appomattoxadvisory.com Home
appomattoxadvisory home disclosure contact team investment appomattox advisory advice provide fund risk strategies manager management capital independent asset multi macro allocation ongoing derived added value views unique processes selection informed achieving floor avenue fifth new york fax tel returns adjusted
Appomattoxadvisory.com  ~   Site Info   Whois   Trace Route   RBL Check  
donorex.com DonorEx | Registration Form
donorex registration form hospitals home unsubscribe privacy disclosure policy area blood email diudelhigoagujaratharyanahimachal havelidaman pradeshjammu nagar pradeshassambiharchandigarhchhattisgarhdadra city district pradesharunachal pradeshuttarakhandwest nadutripurauttar pradeshmaharashtramanipurmeghalayamizoramnagalandorissapuducherrypunjabrajasthansikkimtamil kashmirjharkhandkarnatakakeralalakshadweepmadhya bengal mobile donor islandsandhra state nicobar andaman years age affirm registering sms provided medically legally donate
Donorex.com  ~   Site Info   Whois   Trace Route   RBL Check  
kosenergy.com KOS Energy Ltd.
kosenergy kos read energy disclosure disclaimer oil production click kentucky companies door corporate update gas thousands capital smaller territory prime december success september introductionto appalachian basin major hundreds potential unless boepd risking amounts huge acres rights workover landowners individual rarely
Kosenergy.com  ~   Site Info   Whois   Trace Route   RBL Check  
theguideonwhattobuyyourguy.com The Guide on What to Buy Your Guy
theguideonwhattobuyyourguy guy guide buy disclosure privacy disclaimer story read statement rss subscribe outside view posts march link permanent filed isn electronic blog home magazine wpzoom monograph comments jump probably stories information com easier define constitutes hard say advertisements content accuracy
Theguideonwhattobuyyourguy.com  ~   Site Info   Whois   Trace Route   RBL Check  
ebottrading.com E-BOT TRADING-Home
ebottrading trading bot home risk disclosure statement map site futures open account platforms products premier trade firm commodity investors seasoned suitable skills loss experienced professionals satisfying pros demanding involves options needs trader diamond market comm news services freebies fees
Ebottrading.com  ~   Site Info   Whois   Trace Route   RBL Check  
honorverus.com HonorVerus Research
honorverus research llc principal disclosure home login jobs contact trading rss assistant investment blvd suite underhill direction market assess reserved rights help copyright fax phone syosset risk futures focused specializes firm alternative management approach employing cutting edge nature averse extensive
Honorverus.com  ~   Site Info   Whois   Trace Route   RBL Check  
kitbbsr.ac.in KIT, BHUBANESWAR
kitbbsr kit bhubaneswar ragging curbing menace mandatory disclosure technology koustuv serve institute course year learning institutions group institution world leadership education committed bucket managed filling chairman degrees pravat dynamic lighting established resources greatest news build technical level excellence graduate university
Kitbbsr.ac.in  ~   Site Info   Whois   Trace Route   RBL Check  
manufacturedlending.com Manufactured and Mobile Home Financing, loans and mortgages
manufacturedlending logo statement org freetwitterbuttons home loan manufactured disclosure privacy calculator loans mortgages mobile financing housing land lender programs mortgage range built service offer services industry com professionals today contact financial tell finance needs competitors apart complete site residential set
Manufacturedlending.com  ~   Site Info   Whois   Trace Route   RBL Check  
ezcashloans.com EzCashLoans.com
ezcashloans com home faq fees disclosure testimonials feed comments page rsd cash minutes day account credit loans fast checking address business bank deposited need getting directly money office right months approved comfort statement bad utility turned lenders apply problem recent
Ezcashloans.com  ~   Site Info   Whois   Trace Route   RBL Check  
howdoigetmycreditscore.org How Do I Get My Credit Score?
howdoigetmycreditscore score credit privacy policy contact disclosure permanent link rss sitemap home org information rsd atom march www web cookies content site party use advertising website google cookie browser sites topics dart files log internet beacons used compensation user questions
Howdoigetmycreditscore.org  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 282/494« Previous280281282283284Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com