donegal - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Donegal: 3,904 results found.

stoneywaysltd.com Stoneyways Ltd
stoneywaysltd stoneyways stone contact portfolio welcome tipperary field old slate pillars granite donegal landscaping bridges work cladding paving clare laughlin log michael form home read default purple white rss black blue red green years corner feature stones build ideal supply
Stoneywaysltd.com  ~   Site Info   Whois   Trace Route   RBL Check  
cronacottage.com Crona Cottage
cronacottage cottage crona accomodation activities contact location welcome rates home site updated luxurious holiday nestled donegal seashore bay
Cronacottage.com  ~   Site Info   Whois   Trace Route   RBL Check  
rosevillehouse.net rosevillehouse.finnvalleyvoice.com - H-SPHERE
Roseville House B&B,B&B Donegal,Roseville,Roseville House, Donegal, Ballybofey, stranorlar, drumboe woods,Place to stay Donegal,Mac cumhaill park,Things do do donegal,Good Value
Rosevillehouse.net  ~   Site Info   Whois   Trace Route   RBL Check  
bobbykerr.com Bobby Kerr
bobbykerr bobby kerr business newstalk insomnia donegal enterprising week logo cityhallwok header cafe zambia link permanent build news fairtrade foundation march coming ulster cancer board speaking competition good develop idea giving start join public mar team charities bang twitter feed
Bobbykerr.com  ~   Site Info   Whois   Trace Route   RBL Check  
mariekeating.ie Marie Keating Foundation – Information about Cancer, Ireland
mariekeating keating marie cancer foundation information ireland family fundation photo twitter facebook april donegal stranorlar women donate awareness news cervical events ball ribbon pink campaign carrigans suir ctr resource johnston night nurse disco ask line shop ballybofey athy auction annual
Mariekeating.ie  ~   Site Info   Whois   Trace Route   RBL Check  
stayirish.com Hotels Ireland Search - Hotels, Bed and Breakfast, Self Catering and Hostels in Ireland
stayirish ireland hotels search hostels catering self bed breakfast tipperary sligo kerry clare limerick wicklow armagh mayo antrim kilkenny galway joomla dublin donegal gnu cork license gpl accommodation golf counties food hotel location book culture holiday cavan date engine irelandantrimarmaghcarlowcavanclarecorkderrydonegaldowndublinfermanaghgalwaykerrykildarekilkennylaoisleitrimlimericklongfordlouthmayomeathmonaghanoffalyroscommonsligotipperarytyronewaterfordwestmeathwexfordwicklowregion
Stayirish.com  ~   Site Info   Whois   Trace Route   RBL Check  
brsinsurance.com BRS Insurance
brsinsurance insurance brs quote group request personal home business contact professional blog erie people progressive grange agents anthem united healthcare safeco donegal smiling foremost web works legend today llc information facebook linkedin agency service bush products shea serving needs loveland
Brsinsurance.com  ~   Site Info   Whois   Trace Route   RBL Check  
brtinsurance.com BRS Insurance
brtinsurance insurance brs quote group request personal home business contact professional blog erie people progressive grange agents anthem united healthcare safeco donegal smiling foremost web works legend today llc information facebook linkedin agency service bush products shea serving needs loveland
Brtinsurance.com  ~   Site Info   Whois   Trace Route   RBL Check  
mtwatershed.com Mountain Watershed Association
mtwatershed mountain watershed association email icon intent fish bullet upcoming events donegal mwa list mail newsletter home marcellus news jim click support marketing contribute info site search pollution action projects report newsletters amd page reporting resources issues contact forms free
Mtwatershed.com  ~   Site Info   Whois   Trace Route   RBL Check  
mundy.ie Mundy | Official website of Irish singer-songwriter, Mundy
mundy website official songwriter singer irish news new live oxegen lie wonderful shuffle donegal tour free music album shows song newsletter sign view festival acoustic rock itunes picnic buncrana earthcore mayday posts electric portlaoise tipperary suir bunbeg barra clonakilty kavanagh
Mundy.ie  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 206/245« Previous204205206207208Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com