dry - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Dry: 90,287 results found.

familywineriesdrycreekvalley.com Family Wineries Tasting Rooms Dry Creek Valley and Kenwood Sonoma County CA
Over a dozen Family Wineries in 2 locations Dry Creek Valley, Healdsburg and Kenwood, Heart of Sonoma Valley, Sonoma County, California
Familywineriesdrycreekvalley.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: familywineriestastingroom.com - familywines.com
sandiegodrycleaner.com San Diego Dry Cleaner | Top Dry Cleaner in San Diego, CA
San Diego Dry Cleaner - Let us help you find the top Dry Cleaner in San Diego, CA. Find addresses, phone numbers, driving directions, reviews and ratings on sandiegodrycleaner.com
Sandiegodrycleaner.com  ~   Site Info   Whois   Trace Route   RBL Check  
winzercleaners.com Winzer Dry Cleaning | NYC Dry Cleaning | Mascot, Theatrical Costume Cleaning | Rug, Draperies, Fur, Leather, Suede, UGG Cleaning
New York City's Finest Dry Cleaning. Dry Cleaning of Theatrical costumes, mascot cleaning and repair, Ugg Boot Cleaning, leather, upholstery & draperies. Environmental dry cleaner. Wet Cleaning and Dry Cleaning.
Winzercleaners.com  ~   Site Info   Whois   Trace Route   RBL Check  
drycreekdesignslandscape.com Dry Creek Designs & Garden Care
Providing top quality garden design and landscape care in the Healdsburg area for over 15 years.
Drycreekdesignslandscape.com  ~   Site Info   Whois   Trace Route   RBL Check  
dry-spraying.com Dry Spraying - Werner Mader GmbH
Die Werner Mader GmbH wurde im Frühjahr 1991 gegründet und baut Maschinen und Zubehör für die Bauwerkserhaltung, die Betoninstandsetzung und den Ingenieurbau
Dry-spraying.com  ~   Site Info   Whois   Trace Route   RBL Check  
drystack.co.uk MDL Marinas : MDL Dry Stack: UK
Marina developments Ltd Dry Stack
Drystack.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
chem-dryoforange.com Carpet Cleaner | Orange, CA - Chem-Dry of Orange
Chem-Dry of Orange in Orange, CA provides environmentally-friendly carpet cleaning for homes and businesses. For 24 / 7 service, call 949-955-0845.
Chem-dryoforange.com  ~   Site Info   Whois   Trace Route   RBL Check  
fluffybearcleaners.com Fluffy Bear Coin Laundry & Dry Cleaners – Home
We offer laundry and dry cleaning services for your convenience. There is always an attendant on the premises.
Fluffybearcleaners.com  ~   Site Info   Whois   Trace Route   RBL Check  
navasdrywall.com Drywall Idaho Falls, ID - Nava's Dry Wall Finisher
Nava's Dry Wall Finisher provides Repairing Drywall to Idaho Falls, ID. Call 208-360-0540 for inquiries.
Navasdrywall.com  ~   Site Info   Whois   Trace Route   RBL Check  
richmondcleaners.net Richmond Dry Cleaners LTD.
Richmond Dry Cleaners, Grande Prairie, Alberta. Your Professional Dry cleaners since 1961. We specialize in fine dry cleaning, and we also do heavy oil patch and industrial cleaning. Come and Visit us today!
Richmondcleaners.net  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 127/588« Previous125126127128129Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com