dry - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Dry: 90,287 results found.

rodsrub.com Rod's Rub Dry Rub
Rod’s Rub is an all-natural, low-sodium, no MSG dry rub and comes in 5 great all-natural flavors.
Rodsrub.com  ~   Site Info   Whois   Trace Route   RBL Check  
carycmdry.com Carpet Cleaning, Upholstery Deodorizing, Stain Removal, Chem-Dry of Cary, Cary, NC
Chem-Dry of Cary offers fabric and carpet cleaning services for Cary, Apex, Morrisville, Holly Springs & Wake County. For a healthy and allergen free home call Chem-Dry of Cary.
Carycmdry.com  ~   Site Info   Whois   Trace Route   RBL Check  
makcleaners.com Dry cleaning, MAK Cleaners San Diego, CA Home
Dry Cleaning
Makcleaners.com  ~   Site Info   Whois   Trace Route   RBL Check  
monroedrycleaning.com Monroe Dry Cleaning | Located in Monroe Ohio
Monroe Dry Cleaning is located in Cincinnati, Ohio. We all want high quality cleaning services, reasonable prices, and great customer service. More than that, it is nice to have a cleaner who knows how the customers prefer their garments to be cared for. That's the way Monroe Dry Cleaning has done business for over 10 years.
Monroedrycleaning.com  ~   Site Info   Whois   Trace Route   RBL Check  
winfreychemdrycarpetcleaning.com Carpet Cleaning Des Moines IA Chem-Dry Carpet Cleaners
Carpet Cleaning Pet Urine Removal Pet Odor Upholstery Cleaning Chem Dry Cleaning
Winfreychemdrycarpetcleaning.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: winfreychemdry.com
clothesbasket.net Dry Cleaners Paw Paw, MI (Michigan) - The Clothes Basket
The Clothes Basket of Paw Paw, MI offer's the area's leading dry cleaning and laundry services. Pick-up & delivery at no additional cost! 269-657-6441

Clothesbasket.net  ~   Site Info   Whois   Trace Route   RBL Check  
houstonqualityhomes.com HoustonQualityHomes.com by Owen L. Dry
Owen L. Dry of HoustonQulaityHomes.com specializes in buying, selling or leasing real estate properties and residential homes and relocation and internet sales in Katy and West Houston, Texas
Houstonqualityhomes.com  ~   Site Info   Whois   Trace Route   RBL Check  
fscd2.com Chem-Dry Carpet Cleaning
Four Seasons Chem-Dry Carpet Cleaning, Rug, Furniture, Tile, Grout, Stone Cleaning. Safe and nontoxic. Dries in 1-2 hours not days
Fscd2.com  ~   Site Info   Whois   Trace Route   RBL Check  
hofcleaners.net Dry Cleaning Downers Grove, IL - Hof Cleaners 630-322-9404
Hof Cleaners provides Dry Cleaning services, Evening gowns, St. John knits, Wedding gowns to Downers Grove, IL. Call 630-322-9404.
Hofcleaners.net  ~   Site Info   Whois   Trace Route   RBL Check  
kempsdrycarpetcleaning.com Kemp's Dry Carpet Cleaning - Serving Ocean city Maryland, Ocean pines/Berlin Maryland, Fenwick Island/Bethany Beach Delaware
Kemp's Dry Carpet Cleaning, serving coastal Delaware and Maryland, will revive soiled, matted carpets using the HOST Dry Extraction Carpet Cleaning System. Kemp's Dry Carpet Cleaning also uses a foam extraction system to revitalize upholstery.
Kempsdrycarpetcleaning.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 198/588« Previous196197198199200Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com