durham - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Durham: 30,554 results found.

patbartee.com Pat Bartee
View real estate and homes for sale in Durham
Patbartee.com  ~   Site Info   Whois   Trace Route   RBL Check  
samsequipmentrepair.com Sam's Repair Company, Inc. - Small & Large equipment Repair - Routine Maintenance & Service on Vehicles & Trucks - Durham, N.C.
Equipment and Vehicle Repair Shop located in Durham N.C.
Samsequipmentrepair.com  ~   Site Info   Whois   Trace Route   RBL Check  
trianglehoos.org Triangle Hoos — UVA Club of the Triangle | Raleigh - Durham - Chapel Hill
UVA Club of the Triangle | Raleigh - Durham - Chapel Hill
Trianglehoos.org  ~   Site Info   Whois   Trace Route   RBL Check  
aberdeendigitalarchiving.com Along the Garafraxa Trail DVD History Series
Histories of Glenelg, Durham, Egremont, Normanby, Bentinck Priceville & Durham Road Black Pioneer Settlement.
Aberdeendigitalarchiving.com  ~   Site Info   Whois   Trace Route   RBL Check  
box2bfitbootcamps.com Raleigh/Durham Boxing Boot Camp Fitness, personal fitness training and boxing personal fitness training and group personal fitness training in Raleigh and Durham North Carolina
Raleigh/Durham Boxing Boot Camp Fitness, personal fitness training and boxing personal fitness training and group personal fitness training in Raleigh and Durham North Carolina
Box2bfitbootcamps.com  ~   Site Info   Whois   Trace Route   RBL Check  
christiancounselingincary.com LifeCare Counseling & Coaching (Christian Counseling, Raleigh, Durham, Cary) Home
Professional christian counseling (counselor) and therapy services for adults and adolescents Raleigh, Durham and Cary, NC., Christian Therapy, Christian Therapist, Christian Counselor, EMDR, Trauma, PTSD
Christiancounselingincary.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: christiancounselinginraleigh.com - christiancounselorincary.com - christiancounselorinraleigh.com - lifecarecc.com
drpdl.com Durham Region Pub Dart League | Online Sports Administration System
Online statistics for this league's team and player statistics, schedules, results, news and other information.
Drpdl.com  ~   Site Info   Whois   Trace Route   RBL Check  
grovesidecemetery.com GROVESIDE Municipal Cemetery located in the Town of Whitby, Ontario, Durham Region.
GROVESIDE Municipal Cemetery located in the Town of Whitby, Ontario, Durham Region.
Grovesidecemetery.com  ~   Site Info   Whois   Trace Route   RBL Check  
kellerwilliamsrealtychapelhill.com Modi Real Estate- Chapel Hill, Durham, Chatham, RTP, Raleigh
Professional, cutting Edge real estate service for Your Home * Chapel Hill, Durham, Chatham County, RTP, Cary & Raleigh. * Specializing in helping buyers get the most for their money...I know where the deals are!
Kellerwilliamsrealtychapelhill.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: modirealestate.com
ncdetectiveagency.com Private Investigator Serving Raleigh, Cary, Durham, & Wake Forest, NC - Local Search - LocalEdge.com
NC Detective Agency is a private investigator who serves Raleigh, Apex, Cary, Durham, Wake Forest, & Knightdale in NC. Call 919-899-9740 today!
Ncdetectiveagency.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 265/548« Previous263264265266267Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com