dwi - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Dwi: 18,614 results found.

claytondickinsonlaw.com Divorce Family Law Criminal Defense Attorney Clayton R. Dickinson, Tacoma, Washington DUI DWI Personal Injury Wills Probate Lawyer
Clayton R. Dickinson in Tacoma, Washington, practices in the areas of family law, criminal defense, personal injury, and wills and probate administration.
Claytondickinsonlaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
coreystackhouse.com J. Corey Stackhouse l Attorney at Law l Farmington, NM (505) 327-7171
Law Office of James Corey Stackhouse. Located at 506 W. Arrington, Farmington, NM 87401. (505) 327-7171. J. Corey Stackhouse is an Attorney with a focus in DUI, DIvorce, Domestic Violence, Traffic Offenses, and Criminal Defense.
Coreystackhouse.com  ~   Site Info   Whois   Trace Route   RBL Check  
deamorinlaw.com NJ Real Estate Lawyer, Short Sales, Drunk Driving, Traffic Ticket Attorney, Immigration
New Jersey Lawyer, Real Estate, Short Sales, Mortgage Refinance, DWI, Traffic Tickets, Immigration, Auto Accident, Work Injury, Landlord/Tenant Eviction, Corporation, Wills
Deamorinlaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
deditha.com Deditha
deditha for blog review and information
Deditha.com  ~   Site Info   Whois   Trace Route   RBL Check  
firststepraleigh.com First Step Services LLC of Raleigh.
NC DWI Assessments. Professional Alcohol & Drug Counseling services for individuals, groups, & couples in Raleigh NC.
Firststepraleigh.com  ~   Site Info   Whois   Trace Route   RBL Check  
hillandraineyattorneys.com Colonial Heights Adoptions Attorneys | Virginia Bankruptcy and Creditor Collection, Civil Litigation Lawyers, Law Firm - Hill and Rainey Attorneys
Colonial Heights Adoptions Attorneys of Hill and Rainey Attorneys pursue cases of Adoptions, Bankruptcy and Creditor Collection, and Civil Litigation in Colonial Heights Virginia.
Hillandraineyattorneys.com  ~   Site Info   Whois   Trace Route   RBL Check  
idefendyou.com Attorneys Richard R. Uslan, P.A. Somerville New Jersey NJ Juvenile Crimes DUI / DWI Drug Violations Criminal Law Lawyers
The law firm of Richard R. Uslan, P.A. is located in Somerville, New Jersey, and provides legal representation for drunk driving, driving under the influence, juvenile delinquency and expungement.
Idefendyou.com  ~   Site Info   Whois   Trace Route   RBL Check  
inezlaw.com Law Office of Inez de Ondarza
Located in Apex, North Carolina, the Law firm of Inez de Ondarza focuses primarily on business and commercial litigation.
Inezlaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
joycephoenixlaw.com Family Law & Criminal Defense Attorney Richmond, TX
Law Office of Joyce M Phoenix PLLC has been providing your family with legal assistance to Richmond and Houston for 20 years. Call 281-633-0980 today.
Joycephoenixlaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
mechanicvilletrafficlawyer.info Mechanicville $195 Traffic Lawyer - NY Speeding Ticket Attorney Randall Kehoe
Mechanicville NY speeding ticket and DWI defense in Saratoga County. Law Office of Randall E. Kehoe is one of Upstate New York's most experienced Vehicle & Traffic and DWI defense firms. We can save you a trip to court and hundreds of dollars ...
Mechanicvilletrafficlawyer.info  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 256/454« Previous254255256257258Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com