eldredge - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Eldredge: 439 results found.

freeweaverconsulting.com FreeWeaver Blog
These are Nathanael Schulte's thoughts on life and may not reflect those found in the rest of the world.
Freeweaverconsulting.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: nathanaelschulte.com - nathanaelschulte.info
lions-of-the-lamb.com Lions of the Lamb | Wild at Heart Boot Camp - South Africa
Lions of te Lamb // Wild at Heart Boot Camp - South Africa
Lions-of-the-lamb.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: lions-of-the-lamb.net - lions-of-the-lamb.org
agenteldredge.com Equity - Home Page
Equity , Real Estate Listings and homes for sale, local information, free advice for home buyers and sellers.
Agenteldredge.com  ~   Site Info   Whois   Trace Route   RBL Check  
leigh-i-am.com Leigh Meydrech's Home Page
Leigh Meydrech's home page with many skating pictures.
Leigh-i-am.com  ~   Site Info   Whois   Trace Route   RBL Check  
thewildlands.com The Wildlands Ministry
THE WILDLANDS MINISTRY, bringing young men into the truth of God, through Jesus Christ. Author, Xan Hood. Unatamed - Becoming the man you want to be.
Thewildlands.com  ~   Site Info   Whois   Trace Route   RBL Check  
medicalmalpracticelawyerdenver.com Medical Malpractice Lawyer Denver
A directory listing of medical malpractice lawyer in Denver, CO and surrounding areas.
Medicalmalpracticelawyerdenver.com  ~   Site Info   Whois   Trace Route   RBL Check  
sadowexcavation.com Home
Roofing Service
Sadowexcavation.com  ~   Site Info   Whois   Trace Route   RBL Check  
scoopdeck.com Scoop Deck Ice Cream in Wells Maine, Ice Cream In Wells Beach, Maine, Ice Cream in Southern Maine
Ice cream take out serving ice cream cones, sorbet, sherbert, soft serve, frozen yogurt, hot dogs, beverages and more in Wells Maine. Our home made waffle cones are made fresh daily.
Scoopdeck.com  ~   Site Info   Whois   Trace Route   RBL Check  
darrenbarkman.com Home - www.darrenbarkman.com
A personal website...and so much more. Politics, Christianity, culture and my sometimes intelligent ramblings.
Darrenbarkman.com  ~   Site Info   Whois   Trace Route   RBL Check  
fossilsrefutedarwinism.com Living-Fossils.com
Living-fossils.com has been prepared in order to put an end to the mentality that causes these fossils, that represent a complete response to Darwinism, to be hidden away, and that prevents them from being placed before the public.
Fossilsrefutedarwinism.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: living-fossils.com
 


Page 8/26« Previous678910Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com