emergency - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Emergency: 196,865 results found.

missoula-ems.com Missoula Emergency Services Incorporated
Missoula Emergency Services Inc.
Missoula-ems.com  ~   Site Info   Whois   Trace Route   RBL Check  
emergency-towing-seattle.com Seattle's Best Emergency Towing Service | Towing Seattle emergency
Car won’t start? Looking for a quick car tow? ET Towing Seattle is available 24 hours a day for emergency roadside assistance and any Seattle towing services such as: flatbed tow, tow dolly, junk ca
Emergency-towing-seattle.com  ~   Site Info   Whois   Trace Route   RBL Check  
teesvalleyemergencyplanning.info Redirecting to Cleveland Emergency Planning
Information regarding the management of major incidents and disasters in the former Cleveland area
Teesvalleyemergencyplanning.info  ~   Site Info   Whois   Trace Route   RBL Check  
cardiofoundation.org Cardiovascular Research and Education Foundation
The mission of the Cardiovascular Research and Education Foundation of Indiana, Inc., is to advance knowledge and prevention initiatives for the treatment of cardiovascular diseases in Central Indiana. It exists to support research and educational programs for both those individuals involved in the healthcare industry and the public at large.
Cardiofoundation.org  ~   Site Info   Whois   Trace Route   RBL Check  
emergencymoveshawaii.com Movers Honolulu, HI ( Hawaii ) - Emergency Moves 808-227-9340
Emergency Moves provides residential, commercial and industrial moving services in the Honolulu, HI area. Call us at 808-227-9340.
Emergencymoveshawaii.com  ~   Site Info   Whois   Trace Route   RBL Check  
emergency-preparedness.info Emergency Preparedness :: Columbia Fire & Safety Ltd. :: Be Personally Prepared
Emergency Preparedness is everyone's responsibility. Columbia Fire and Safety Ltd has a wide variety of survival kits and disaster equipment available online.
Emergency-preparedness.info  ~   Site Info   Whois   Trace Route   RBL Check  
readerrescue.com Paris Presents: High-Quality Bath & Beauty Products at Affordable Prices
Paris Presents creates and distributes makeup tools, bath and body products, travel accessories, nail and specialty beauty products at affordable prices worldwide.
Readerrescue.com  ~   Site Info   Whois   Trace Route   RBL Check  
emergencyspecialties.com Emergency Specialties Official website
Your Source For Round The Clock Monitored Medical Alert Systems and Personal Emergency Response Systems (PERS).
Emergencyspecialties.com  ~   Site Info   Whois   Trace Route   RBL Check  
emergencydentistutah.com Emergency Dentist Utah
Need an emergency dentist in Utah? These dentists offer emergency dental services in the Salt Lake Valley.
Emergencydentistutah.com  ~   Site Info   Whois   Trace Route   RBL Check  
orangecountyemergencyvet.com Central Orange County Emergency Animal Hospital | Newport Beach, Irvine, Corona Del Mar, Costa Mesa, California | Emergency Vet Clinic
Central Orange County Emergency Animal Hospital is the premier emergency veterinary center serving pet owners and primary-care veterinarians in Newport beach, Irvine, Corona del Mar, Costa Mesa, Huntington Beach, Fountain Valley, Laguna, Lake Forest, Mission Viejo, Garden Grove, Tustin and Orange.
Orangecountyemergencyvet.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 38/568« Previous3637383940Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com