englewood - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Englewood: 9,055 results found.

torresgroup.net Denver, Centennial, and Englewood, Real Estate - Jack Torres
Highlands Ranch real estate, Lone Tree real estate, Homes for sale in Centennial and Englewood. Your Denver real estate resource center, find MLS listings, condos and homes for sale in Denver
Torresgroup.net  ~   Site Info   Whois   Trace Route   RBL Check  
bestcleaningservicellc.com   Pressure Cleaning Services Residential - Englewood, NJ - Best Cleaning Service
Best Cleaning Service offers residential pressure cleaning services in Englewood, NJ.
Bestcleaningservicellc.com  ~   Site Info   Whois   Trace Route   RBL Check  
coloradoframing.com Custom Framing Denver - Customer Framing Testimonials - Frame de Art, Englewood Colorado
Frame De Art your custom framing company located in Englewood Colorado frames your fine painting, sports memorabilia, a family photograph, or a poster.
Coloradoframing.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: framedeart.biz - framedeartdenver.com - framedeart.info - framedeartonline.com - framedeartonline.info
medicalmalpracticelawyerdenver.com Medical Malpractice Lawyer Denver
A directory listing of medical malpractice lawyer in Denver, CO and surrounding areas.
Medicalmalpracticelawyerdenver.com  ~   Site Info   Whois   Trace Route   RBL Check  
lakewoodranchkw.com Keller Williams Sarasota, Lakewood Ranch and Englewood
Looking for Sarasota Real Estate, Waterfront Properties, Siesta Key Homes for Sale, Bradenton Real Estate, Longboat Key Beach Property, Luxury Homes and Commercial Real Estate for Sale on the Gulf Coast of Florida visit Keller Williams
Lakewoodranchkw.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: manateekw.com
paradisejim.com Venice, Nokomis, and Englewood, Real Estate - Jim Bath
Venice, real estate and homes for sale in Nokomis and Englewood. Your Venice real estate resource center, find MLS listings, condos and homes for sale in Venice
Paradisejim.com  ~   Site Info   Whois   Trace Route   RBL Check  
salonrocks.com Salon Rocks Hair Salon - Englewood, NJ & Bergen County
Salon Rocks in Englewood, NJ serves Bergen County, NYC and surrounding areas - providing hair cuts, hair styling, and hair coloring for both men and women. Salon Rocks specializes in women’s hair coloring, extensions, straightening, corrective color, highlighting, Bridal hair styling, coloring grey, highlights for full head, partial head and highlights with glaze. Salon Rocks also does hair painting, Bali age, Paneling color, zonal color, square color, cross color, peek-a boo coloring techniques, and dimensional hair coloring.
Salonrocks.com  ~   Site Info   Whois   Trace Route   RBL Check  
santafeeventflorist.com Santa Fe Event Florist - Englewood, CO, 80110 - Delivering Fresh Flowers and Gifts
Santa Fe Event Florist - Englewood, CO, 80110 Flower and gift ordering locally to Englewood, CO or worldwide via our international delivery. Buy flowers online for same day and next day local florist delivery.
Santafeeventflorist.com  ~   Site Info   Whois   Trace Route   RBL Check  
athomebutnotalone.com Pet Sitter and Dog Walker in Port Charlotte and Englewood, FL
Pet Sitting service in Port Charlotte, Englewood, North Port, Rotonda, Placida, Cape Haze and Boca Grande, Florida
Athomebutnotalone.com  ~   Site Info   Whois   Trace Route   RBL Check  
bobbishappygarden.com Happy Gardens Floral - Englewood, CO, 80113 - Delivering Fresh Flowers and Gifts
Happy Gardens Floral - Englewood, CO, 80113 Flower and gift ordering locally to Englewood, CO or worldwide via our international delivery. Buy flowers online for same day and next day local florist delivery.
Bobbishappygarden.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 69/452« Previous6768697071Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com