excellent - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Excellent: 166,548 results found.

techliciousness.com Techliciousness - HotHardware Forums
HotHardware.com's Forum Community Of Tech Enthusiasts And Power Users
Techliciousness.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: techliciousness.info - techliciousness.net - techliciousness.org
terrifictowns.com Central Lake, Michigan - Chamber of Commerce - excellent for family vacations !!
Central Lake MI -. Ideal for family vacations - Great fishing, hunting. & golf. Near ski resorts & snowmobile trails, Traverse City, Petoskey, Charlevoix area
Terrifictowns.com  ~   Site Info   Whois   Trace Route   RBL Check  
texasfamilyatvpark.com Family Fun ATV Park
Family camping, fishing, ATV park in Freestone County, Texas
Texasfamilyatvpark.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: texasfamilycampingfishingatvpark.com
thephysiocentre.co.uk The Physio Centre | Waterlooville | About Us
The Physiotherapy Centre is a well established, private Physiotherapy practice, serving people from all areas in Hampshire especially surrounding Widley and Waterlooville.
Thephysiocentre.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
theultimatecartoys.com Theultimatecartoys.Com - Quality Car Audio/Stereo Deals At Excellent Prices
High quality brand name car audio, video and accessories
Theultimatecartoys.com  ~   Site Info   Whois   Trace Route   RBL Check  
the-window-boutique.com The Window. Online-Boutique For Excellent Designer Eyewear And Accessories. - Online-Boutique For Excellent Designer Eyewear And Accessories.

The-window-boutique.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: the-window-boutique.net - the-window.net
tsautah.org Free Games
Most Excellent Games
Tsautah.org  ~   Site Info   Whois   Trace Route   RBL Check  
twojokerswithasmoker.com TWO JOKERS BARBEQUE CATERING
Two Jokers with a Smoker provides quality smoked and barbequed. Two Jokers have been awarded Blue Ribbons for their signature barbeque and smoked meats.
Twojokerswithasmoker.com  ~   Site Info   Whois   Trace Route   RBL Check  
ultimateperfectworkout.com Excellent Perfect Pushups| Perfect Abs DVD | Effective P90x Beach Body
Ultimateperfectworkout.com provides a range of products like p90x workout DVD, perfect abs dvd, p90x workout videos and some p90x reviews to guide the user.
Ultimateperfectworkout.com  ~   Site Info   Whois   Trace Route   RBL Check  
upnorthhost.com Up North Hosting Excellent Service! Text Ad Exchanges, Safelists and More!
Enter description of your site here!
Upnorthhost.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 164/542« Previous162163164165166Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com