federal - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Federal: 147,850 results found.

federaltaxcalculatorus.com Federal Tax Calculator 2011 – Federal Tax Calculator, Tax Refund Estimator 2010, 2011.
Federal tax calculator 2011, tax refund estimator, tax refund calculator 2010 and tax calculator 2011 help you to calculate your 2010 taxes online. Estimate your 2010, 2011 taxes with federal tax calculator online.
Federaltaxcalculatorus.com  ~   Site Info   Whois   Trace Route   RBL Check  
federalreplacement.com Federal Replacement
Federal Replacement is the division of HJ Diamonds that handles the replacement of lost, stolen or otherwise damaged pieces of insured jewelry.
Federalreplacement.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: jewelryreplacementfederalreplacement.com
federaltaxcentral.com Federal IRS Tax Central: Federal IRS Tax Help
Federal (IRS) tax resources, help and answers to thousands of federal tax questions. Complete guide to federal tax amnesty, federal tax forms, and...
Federaltaxcentral.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: fedtaxcentral.com
federalwaychiropractors.com Federal Way Chiropractor Chiropractic Federal Way Washington Chiropractors WA 98003
Federal Way Chiropractor Dr. Kevin Jex of Jex Chiropractic Health Center, a Federal Way Washington WA 98003 chiropractic clinic, is your preferred chiropractor.
Federalwaychiropractors.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: jexchiro.com
federalwaybankruptcyattorney.com Federal Way Bankruptcy Attorney | WA State Bankruptcy Lawyer -
Federal Way bankruptcy attorney and WA State bankruptcy lawyer. Need help with a WA State bankruptcy? Talk to a Federal Way, WA bankruptcy lawyer!
Federalwaybankruptcyattorney.com  ~   Site Info   Whois   Trace Route   RBL Check  
how-to-hide-a-corpse-on-federal-land.com How to hide a corpse on federal land dot com
A site dedicated to public art on public land.
How-to-hide-a-corpse-on-federal-land.com  ~   Site Info   Whois   Trace Route   RBL Check  
myfederalresume.com Federal Governement Resume Writing Service | Federal Resumes
Federal resumes expertly written by professional and certified writers. Land the perfect government job. All grade levels
Myfederalresume.com  ~   Site Info   Whois   Trace Route   RBL Check  
fedeng.com Telecommunications Consulting and Systems Engineering Services | Federal Engineering
Federal Engineering is an independent, worldwide systems engineering and consulting firm specializing in the planning, design, and implementation of state-of-the-art telecommunications systems.
Fedeng.com  ~   Site Info   Whois   Trace Route   RBL Check  
federalgovernmentcontractorfinancing.com Federal Government Contractor Financing, Factoring for Federal Contracts, Lowest Factoring Rates!
Federal Government Contractor Financing, Federal Government Contractor Financing Lines $20K to $10 Million, Low Rates from (1/2%), Call 866.880.7094
Federalgovernmentcontractorfinancing.com  ~   Site Info   Whois   Trace Route   RBL Check  
fflholder.com How to become a FFL Holder, Federal Firearms License Holder. : fflholder.com
Become an FFL Holder by getting the right information. Find easy to follow Federal Firearms License information, how to�s and more, 100% guaranteed! - fflholder
Fflholder.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 36/519« Previous3435363738Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com