foursquare - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Foursquare: 16,963 results found.

winecountrygirl.com Wine Country Girl
winecountrygirl girl country wine wcg contact spilling good sayontan sinha suffusion theme stuff tumblr rss digg foursquare linkedin youtube twitter facebook flickr feed home comments rsd
Winecountrygirl.com  ~   Site Info   Whois   Trace Route   RBL Check  
workinformatica.com Loja Virtual - Work Informática
workinformatica work loja informática virtual twitter com enviar formas pagamento segurança pelo flickr foursquare tube conosco fale privacidade utilidades lista downloads casamento identifique empresa assistência técnica usb detalhescomprar vista juros desconto sem digital notebooks para preta rede sony cyber termica
Workinformatica.com  ~   Site Info   Whois   Trace Route   RBL Check  
dougjaeger.com dougjaeger 33
dougjaeger com
Dougjaeger.com  ~   Site Info   Whois   Trace Route   RBL Check  
marcus-merz.com Der BETA-Blogger
Online Marketing,Social Media Marketing,Web 2.0,SEO,E-Mail-Marketing
Marcus-merz.com  ~   Site Info   Whois   Trace Route   RBL Check  
mctiempomcdinero.com Mc Tiempo Mc Dinero
Mc Tiempo Mc Dinero
Mctiempomcdinero.com  ~   Site Info   Whois   Trace Route   RBL Check  
pitchryder.com Pitch Ryder
pitchryder ryder pitch share youtube topics bangs foursquare twitter facebook video comments vancouver posts music itunes tweet electrik eclectik flashback view lady events crack billboard march dogg soul blues pop hop green commodore beat gaga snoop kaskade kobe morcheeba categories
Pitchryder.com  ~   Site Info   Whois   Trace Route   RBL Check  
rawsouthstreet.com RAW SOUTH STREET | Just another WordPress site
rawsouthstreet raw follow south street apparel wordpress site just art aphillyated history med info shirts live facebook twitter yelp foursquare mail themes elegant feed philly meet jahn publaq saturday gloria velez phillies drive food greet rediroc logo mag infamous entertainment
Rawsouthstreet.com  ~   Site Info   Whois   Trace Route   RBL Check  
wonderm00n.com Wonderm00n | Marco Almeida - A gateway to my digital self
wonderm00n wonderm com http marco self almeida gateway digital portuguese foursquare blog youtube facebook flickr deviantart twitter panoramio english personal www https user portugalemfotos likedby photos don artistic geo stuff day located portugal occasionaly really fotos website depressing interesting attempts
Wonderm00n.com  ~   Site Info   Whois   Trace Route   RBL Check  
adenawindeshaw.com Adenaw Indeshaw – Indeshaw Adenaw
adenawindeshaw indeshaw adenaw wordpress minicard theme download tim damme van vcard inspired home photo feed digg facebook twitter tumblr youtube flickr foursquare picasa myspace linkedin friendfeed diggfacebookflickrfoursquarefriendfeedlinkedinmyspacepicasatumblrtwitterwordpressyoutube email united copyright states phone chicagoil adenawaddress homeabout gmail com org search rsd
Adenawindeshaw.com  ~   Site Info   Whois   Trace Route   RBL Check  
arthurpope.com Spartan Bard - The Creative Things of Arthur Pope - Song
arthurpope comment date creative spartan bard youtube song things pope arthur video commons license player half survivors music lion big vimeo foursquare stumbleupon pandora facebook twitter steam rdio rsd rdf rss atom wasting knows time know come burned saying god
Arthurpope.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 488/527« Previous486487488489490Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com