foursquare - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Foursquare: 16,963 results found.

9thcircle.it 9th Circle Games
9thcircle circle games seguici rss del maggiori informazioni nuovo twitter foursquare deviantart youtube facebook issuu publish eden disponibile gioco autori dice inganno roller roberto intervista ambientazione eventi dicembre ruolo grassi starship della dei download noi lucca tra preordini iphone dispositivi
9thcircle.it  ~   Site Info   Whois   Trace Route   RBL Check  
adriagelato.com Gelateria Adria
adriagelato adria gelateria follow twitter gelato free facebook post ice cream flickr rss foursquare youtube stumbleupon delicious digg favorites menu locations jerry healthy blog welcome contact coffee like wiki days fat taste comparison ehow wordpress recipes values freeze brain social
Adriagelato.com  ~   Site Info   Whois   Trace Route   RBL Check  
ahhyeah.com Douglas Porter –
ahhyeah douglas porter minicard theme wordpress van damme inspired tim youtube blog photo home ankenyiowa comaddress email gmail usa blogpicturestwitterwhere buzzgowallaiphone copyright blogdiggfacebookfavorite homeabout linksfoursquarefriendfeedgoogle feed foursquare links friendfeed google buzz favorite facebook pictures iphone gowalla digg twitter rsd comments
Ahhyeah.com  ~   Site Info   Whois   Trace Route   RBL Check  
apsugreeks.com Austin Peay : Welcome to Fraternity & Sorority Affairs
apsugreeks austin peay fraternity sorority affairs welcome greek council recruitment panhellenic university state home twitter facebook apsu life ifc greeks campus warning youtube foursquare icon went peaynk dance marathon logo national interfraternity hellenic guidelines comments pan schedule events fraternities service
Apsugreeks.com  ~   Site Info   Whois   Trace Route   RBL Check  
badgewiki.com BadgeWiki
Main Page
Badgewiki.com  ~   Site Info   Whois   Trace Route   RBL Check  
bahri.org Bahri Meriç CANLI – Web developer, Mountaineer, Search & rescue team member
bahri canli meriç minicard theme wordpress team member mountaineer rescue developer web search contact inspired damme van tim vcard download photo home infoaddress beslemesi copyright ankara email turkey homeabout saying deliciousdiggfacebookflickrfoursquarefriendfeedlastfmlinkedinmyspacestumbleupontwittervimeoxingyoutube lastfm friendfeed linkedin stumbleupon foursquare twitter myspace xing vimeo
Bahri.org  ~   Site Info   Whois   Trace Route   RBL Check  
carsoniporter.com Douglas Porter –
carsoniporter douglas porter minicard theme wordpress tim damme inspired van youtube photo blog home ahhyeah gmail email copyright buzzgowallaiphone comaddress linksfoursquarefriendfeedgoogle homeabout ankenyiowa usa blogdiggfacebookfavorite blogpicturestwitterwhere feed friendfeed foursquare google gowalla links buzz facebook iphone pictures digg twitter favorite page
Carsoniporter.com  ~   Site Info   Whois   Trace Route   RBL Check  
checkyoponytail.com Check Yo' Ponytail 2 - Monthly at The Echoplex in Los Angeles
checkyoponytail cyp check ponytail angeles los echoplex monthly blog videos events blonde redhead holy ghost posts view iheartcomix rss youtube feed classixx facebook yelp foursquare myspace subscribe contender media twitter presents shows upcoming share photos flyers contact disco mixtapes dfa
Checkyoponytail.com  ~   Site Info   Whois   Trace Route   RBL Check  
cisternaaraus.com CisternaAraus.com
cisternaaraus com chile comercial blog university universidad curriculum wordpress tna alt uchile fen talcahuano wwe ingeniería carleton facebook que bit linkedin youtube foursquare twitter tumblr formspring los esta soy las mejor social sebastián pero sistemas mis les canadá gatineau tengo
Cisternaaraus.com  ~   Site Info   Whois   Trace Route   RBL Check  
cowboycrusadeministries.org Cowboy Crusade Ministries-Main Page
church, cowboy, horse, God, Jesus, rodeo, Church, Cowboys, Lord, foursquare, foursquare church, rodeo church, cowboy church,
Cowboycrusadeministries.org  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 520/527« Previous518519520521522Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com