hampshire - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Hampshire: 71,207 results found.

decembermarketing.com December Marketing - NH Marketing, Advertising & Web Design
A New Hampshire marketing, advertising and web design company
Decembermarketing.com  ~   Site Info   Whois   Trace Route   RBL Check  
firstfencing.co.uk Garden Fencing Hampshire, Gates - Sheds, First Fencing Contractors
Fencing Contractors Hampshire, Dorset, Surrey, Oxfordshire - First Fencing Contractors specialise in all types of fence panels and gates for garden and commercial.
Firstfencing.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
hanoverlions.org Hanover Lions Club of Hanover, New Hampshire
The Hanover Lions Club of Hanover, New Hampshire, is a local affilitate of Lions Clubs International, a worldwide organization dedicated to helping to meet the needs of our global community.
Hanoverlions.org  ~   Site Info   Whois   Trace Route   RBL Check  
hbsfuels.com HBS Fuels - Hampshire's Fuel Oil and Gas Centre
Hampshire's Fuel Oil and Gas Centre, covering a 20 mile radius from Andover in Hampshire.
Hbsfuels.com  ~   Site Info   Whois   Trace Route   RBL Check  
hollographics.co.uk Hampshire Product Design Services | Hampshire CAD Design | CAD Drafting Company | Design
Using the latest CAD solid modelling software Hollographics provides product focussed mechanical computer aided design services
Hollographics.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
imagenationstudio.com Imagenation Love & Beauty Photography | Wedding, Portrait, Boudoir | Hampshire, Berkshire, UK
Imagenation Love & Beauty Photography offer professional on-location photography connected to wedding, engagement as well as family and youth portraits. Imagenation studio photography is dedicated to all women thinking about their dream portrait taken during a sensual boudoir session. Imagenation - a real studio of imagination also welcomes brides-to-be, mums-to-be and everybody else who can dream.
Imagenationstudio.com  ~   Site Info   Whois   Trace Route   RBL Check  
kellerwilliamsmerrimackvalley.com Massachusetts and New Hampshire Home Search
westford, chelmsford, littleton, ayer, groton, acton, lowell, dracut, pepperell, merrimack valley, merrimack valley homes, chelmsford homes, lowell lofts, lowell condo, lowell condos, lowell homes
Kellerwilliamsmerrimackvalley.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: kwchelmsford.com - kwgroton.com - kwlowell.com - kwmerrimackvalley.com - kwrealty-ma.com - kwtyngsboro.com - kwwestford.com - merrimackvalleyrealtors.com
modernarnis.org Profesor Remy Presas's International Modern Arnis Federation
Official site of Grand Master Remy Presas International Modern Arnis Federation. List of IMAF seminars, videos, and books on Filipino jujitsu, karate, and stick fighting. Plus exciting photos.
Modernarnis.org  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: professorpresas.com
nhvacationguide.com New Hampshire Indepth Vacation Guide, White Mountains
New Hampshire White Mountain vacation information guide listing vacations for area dining, lodging, snowmobiling, skiing, attractions, beaches, places to visit, shopping in the great north woods, white mountain region, lakes region, dartmouth-sunapee region, merrimack valley, monadnock region and seacoast region
Nhvacationguide.com  ~   Site Info   Whois   Trace Route   RBL Check  
nhwebsitedesign.com NH Website Design :: Quality and affordable web design for New Hampshire and beyond!
New Hampshire web design firm offering website design services, and internet marketing. Best value in NH for web design and Internet Marketing in New Hampshire
Nhwebsitedesign.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 382/562« Previous380381382383384Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com