hampshire - Search results :.

Site Info   Whois   Traceroute   RBL Check

• Site Info
• Who Is
• Trace Route
• RBL Check
• What's My IP?

Enter Web Site URL Address:
 

Hampshire: 71,207 results found.

New Hampshire Business Web - Web Site Design and Web Site Hosting of Business Web Sites New Hampshire Business Web can provide your company with the needed Internet presence at an affordable cost. NHBweb provides web design, web hosting, domain name registration and web site management. We can provide full support and analysis of search engine listings. Nhbweb.net  ~   Site Info   Whois   Trace Route   RBL Check   Truck Accident Lawyer New Hampshire A directory listing of truck accident lawyer in New Hampshire Truckaccidentlawyernewhampshire.com  ~   Site Info   Whois   Trace Route   RBL Check   Bridal Hair in Hampshire Michelle Crosser has over 20 years experience within the industry and was trained in South Africa. She has run salons on cruise ships and has worked with award winning franchisee salons throughout the UK. Bridalhairinhampshire.com  ~   Site Info   Whois   Trace Route   RBL Check   Similar Sites: bridalhairinhampshire.co.uk A White Mountains Motel in Jefferson, New Hampshire - Evergreen Motel motel in the heart of the White Mountains of New Hampshire across from Santa's Village in Jefferson, NH. Close to snowmobiling, hiking, skiing and the Presidential Range. Evergreenmotelnh.com  ~   Site Info   Whois   Trace Route   RBL Check   North Hampshire Imaging - Radiology Services North Hampshire Imaging is a group of consultant radiologists with services encompassing diagnostic imaging and therapeutic interventions (including ultrasound, CT, PET/CT, MRI scans, x-rays, mammography, fluoroscopy, nuclear medicine and interventional/therapeutic procedures). Hampshireimaging.com  ~   Site Info   Whois   Trace Route   RBL Check   Similar Sites: northhampshireimaging.com The Latest Top New Hampshire News, Articles, and Info Latest New Hampshire articles from New Hampshire PR News. Newhampshireprnews.com  ~   Site Info   Whois   Trace Route   RBL Check   Web Design, iPhone App Development & SEO. Basingstoke, Hampshire - Solvd Ltd Web Design, Hosting & SEO Consultants. Software & Database Development Company. SQL Server, .NET, iPhone/Mobile Apps & DotNetNuke, Basingstoke, Hampshire UK Solvd.co.uk  ~   Site Info   Whois   Trace Route   RBL Check   Similar Sites: webdesignbasingstoke.net - webdesignhants.com - webdesignhants.net - whatalternative.com | Unique Weddings, nashua, new hampshire, massachusetts, boston Hey! Thanks for checking out UniqueDay Events - the family wedding photography & beauty team covering Nashua, Boston, NH, MA, New England & beyond. Uniquedayevents.com  ~   Site Info   Whois   Trace Route   RBL Check   Similar Sites: newenglandweddingphotography.net - uniqueday.com - auniqueday.com Paintball in Hampshire from leading paintball and laser tag site near Southampton and Fareham: Ambush Paintball Paintball in Hampshire: Ambush Paintball is one of Hampshire's leading paintball sites - situated near Wickham, Fareham & Southampton. Book your paintball day online Ambushpaintball.co.uk  ~   Site Info   Whois   Trace Route   RBL Check   Stockbridge Bed and Breakfast, Accommodation, Guest House,Winchester,Salisbury, Hampshire Bed & Breakfast Stockbridge Accommodation Guest House Luxury Houghton Fishing Trout B&B B and B Salmon Hampshire Shooting Cruise Southampton Winchester Weekend Short Break Holiday Special Boutique Yewtreebarn.net  ~   Site Info   Whois   Trace Route   RBL Check

Page 99/562« Previous979899100101Next »

Go to page: