hart - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Hart: 17,182 results found.

vakantieparkendrenthe.com Vakantieparken Drenthe. vakantiepark Drenthe, bungalowparken in Drenthe
Vakantieparken Drenthe. boek een vakantiepark of alle bungalowparken in Drenthe.
Vakantieparkendrenthe.com  ~   Site Info   Whois   Trace Route   RBL Check  
4getaway.com Pagosa Springs lodging - cabins and vacation rentals in Pagosa Springs Colorado offers colorado vacation packages and cabins for rent in Southwest Colorado
Pagosa Springs lodging - cabins and vacation rentals in Pagosa Springs Colorado offers colorado vacation packages and cabins for rent in Southwest Colorado
4getaway.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: hartcabins.com - hartsretreat.com - hartsrockymountainretreat.com - hotspringspagosa.com - pagosafun.com
bml2.co.uk Important BML2 Information, Facts, Figures and News Reports
BML2 - New Oportunities for direct railway links from London to Brighton, Seaford/Newhaven and Eastbourne via Uckfield and Tunbridge Wells.
Bml2.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
greydogdesign.co.uk Graphic design, illustration and photography - East London - Grey Dog Design
Grey Dog Design is the design, illustration and photography of Richard Hart
Greydogdesign.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
innerside.org Praktijk Innerside
Website van praktijk voor natuurgeneeskunde InnerSide
Innerside.org  ~   Site Info   Whois   Trace Route   RBL Check  
kevinkarsch.com Kevin Karsch's Homepage
Homepage for Kevin Karsch, CS PhD student at UIUC
Kevinkarsch.com  ~   Site Info   Whois   Trace Route   RBL Check  
nathascha.com Welkom op de voorpagina van Nathascha.com
Webdesign en webbeheer
Nathascha.com  ~   Site Info   Whois   Trace Route   RBL Check  
criminaldefenselawyerlasvegas.com Las Vegas Criminal Defense Lawyer: Nevada Criminal Attorney
Las Vegas criminal defense lawyer Martin Hart handles cases involving criminal defense, arraignments, domestic violence, DUI, traffic violations, fraud, theft, burglary, drugs, murder, sexual assault and kidnapping
Criminaldefenselawyerlasvegas.com  ~   Site Info   Whois   Trace Route   RBL Check  
innovatorsinmusic.com Innovators in Music
"One of the best music series to be produced in Canada in many, many years" - The Globe & Mail Click HERE to visit our interactive Flash site
Innovatorsinmusic.com  ~   Site Info   Whois   Trace Route   RBL Check  
rchsonline.org Rensselaer County Historical Society
Visit the Rensselaer County Historical Society located in two adjacent 19th Century townhouses.
Rchsonline.org  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 206/594« Previous204205206207208Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com