headshot - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Headshot: 12,030 results found.

gandolphoto.com Christina Gandolfo | Los Angeles Headshot Photographer
unconventional, modern headshots & portraiture for actors, professionals, and models
Gandolphoto.com  ~   Site Info   Whois   Trace Route   RBL Check  
gemcitysurgicalassociates.com Gem City Surgical Associates
Gem City Surgical Associates is a patient-focused general surgical practice.
Gemcitysurgicalassociates.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: gemcitysurgicalassociates.net
trotwoodphysicians.com Trotwood Physician Center
Trotwood Physician Center provides comprehensive care to every member of your family.
Trotwoodphysicians.com  ~   Site Info   Whois   Trace Route   RBL Check  
headshot-photography.com Kevyn Major Howard Studios, Headshot Photography, Portraits, Head Shots, Headshots that open doors
When you need to stand apart from the crowd visit Kevyn Major Howard Photography. Shoot with an ACTOR that understands the business of getting work in Hollywood. Los Angeles Photographer Kevyn Major Howard, Thirty years in the entertainment business.
Headshot-photography.com  ~   Site Info   Whois   Trace Route   RBL Check  
headshotcustom.com Headshot Custom Cases & Computers
We sell everything from custom PC's and cases to accessories.
Headshotcustom.com  ~   Site Info   Whois   Trace Route   RBL Check  
thelondonheadshot.com THE LONDON HEADSHOT
London Headshot Photography. High Quality Headshots Cheapest In London.
Thelondonheadshot.com  ~   Site Info   Whois   Trace Route   RBL Check  
davidjmartin.com Headshot Photography - Home
David J. Martin, New York NY fashion and headshot photographer's portfolio. Headshots, Commercial Print and Fashion
Davidjmartin.com  ~   Site Info   Whois   Trace Route   RBL Check  
beavercreekfamilyphysicians.com Beavercreek Family Physicians
Beavercreek Family Physicians has served the medical needs of the Beavercreek community for over 30 years.
Beavercreekfamilyphysicians.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: beavercreekfamilyphysicians.net - beavercreekfamilyphysicians.org
headshotprint.com Online Headshot Orinting on Real Photographic Paper
Order Headshot Print Online or Walk-In High Quality Headshot Printing No Hidden Fees Ship in 24 Hrs Free Design& Retouch
Headshotprint.com  ~   Site Info   Whois   Trace Route   RBL Check  
losangelesglamour.com Los Angeles Headshot Photography with James Hickey
James Hickey is a LA commercial photographer with an artistic approach to fashion, glamour and beauty. His images are colorful, vibrant and expressive.
Losangelesglamour.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 12/596« Previous1011121314Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com