houses - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Houses: 208,485 results found.

play-houses.co.uk Congratulations! Welcome to your new Web Site!
houses play web site welcome congratulations new macromedia http ftp content html create submit user www publish com guide pro flash paintshop cuteftp fireworks monkey bulletproof builder fetch admin interarchy homepage style dreamweaver goodies yale cnet page files internet administrator
Play-houses.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
arushahouses.com Spanish Houses in Arusha
arushahouses spanish houses arusha luxury vision villas feedback designs custom webmaster com home information mail construction company profile contact send comments copyright site web telephone questions tiles info address general electronic tanzania postal sales njiro spanishtiles support customer fax
Arushahouses.com  ~   Site Info   Whois   Trace Route   RBL Check  
tampa-houses-for-sale.com Tampa-Houses-For-Sale | Just another WordPress site
houses tampa sale site wordpress just
Tampa-houses-for-sale.com  ~   Site Info   Whois   Trace Route   RBL Check  
housesthatwork.com EEBA || Houses That Work
housesthatwork eeba work houses register homes existing building announced educational conference download partners share kit sponsorship contact home feed rss session resources expo learn host bookstore alliances htw science coast new sessions alliance education design energy environmental online looking plan
Housesthatwork.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: housesthatwork.org
4rentsmith.com Tempe Houses 4 Rent
4rentsmith tempe houses rent college edit comments kiwanis park atom area sesame harvard hardy street link permanent post january july home posts bobbi deposit rsd blogger rss search navigation block month tile remodeled posted neighborhood available square smith great new
4rentsmith.com  ~   Site Info   Whois   Trace Route   RBL Check  
robertlewishomes.com RobertLewisHomes.com » Welcome
long island real estate, long island, real estate, houses for sale, broker, real estate broker, century 21
Robertlewishomes.com  ~   Site Info   Whois   Trace Route   RBL Check  
houstonhomerelief.com San Miguel Properties, LLC - Home
Sell house fast stop foreclosure must sell i buy houses
Houstonhomerelief.com  ~   Site Info   Whois   Trace Route   RBL Check  
sellnowcash.com Ca$h 4 Houses LLC | We Buy Houses!
sellnowcash houses home contact faq ca$h llc buy house republic sell fast selling property offer report quickly make email arab islands democratic cash person sales guide states special condition size obligation location address close buyers looking marketing peoples ofmadagascarmalawimalaysiamaldivesmalimaltamarshall yugoslav
Sellnowcash.com  ~   Site Info   Whois   Trace Route   RBL Check  
designing-solar-houses.com Designing-Solar-Houses :: Home Page
designing solar houses home page contact policy privacy faq resources make free payments fast paypal secure com www energy house right cost step manual need design information utility power know water bills like save research learn download news components just
Designing-solar-houses.com  ~   Site Info   Whois   Trace Route   RBL Check  
wrightpattersonhouses.com Wright Patterson Houses
wrightpattersonhouses wright patterson houses sale beavercreek englewood comment home uncategorized wpafb kettering estate real ohio leave posts view new military homes information posted near business house com great base air dayton community force general brigadier commander blog nominated nasic journal
Wrightpattersonhouses.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 394/484« Previous392393394395396Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com