hummel - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Hummel: 2,475 results found.

yourantiquesroadshow.com Free Appraisal -Has an antique roadshow never come to your town?
yourantiquesroadshow aoaonline roadshow town come free newsletter subscribe ask question hummels appraisal antique collection know books magazines worth glad really waited going rare just item hummel appraise itemsi sell looking consigned comic sure threw nearly madison wisconsin contacted sold daniel
Yourantiquesroadshow.com  ~   Site Info   Whois   Trace Route   RBL Check  
all-inter.com all-inter.com
inter com kontakt nye info forside varer www mrker med der til den skla umbro seasons har lager aftale danmark spiller det streetsurfing fremtiden klub som enten bekldning klubben kategorier produkt hummel udstyroutdoor eller forventes nos lavey dag lfc kvinde
All-inter.com  ~   Site Info   Whois   Trace Route   RBL Check  
cheapseatstavern.com Cheap Seats Tavern
cheapseatstavern cheap seats tavern photos contact directions menu home specials friends good great owned time sports meet founded lot brothers fruition long hummel rob dreams chats finally late come night delello copyright personalities better mathews drivehilton phone island head looks
Cheapseatstavern.com  ~   Site Info   Whois   Trace Route   RBL Check  
antiqueswilliamsburg.com Williamsburg Antique Mall - collectables, furniture, books, china, stamps, coins, historic items, featuring La Petite Restaurant, in the Virginia Historic Triangle. Antique and Estate Sale dealers welcome.
antiqueswilliamsburg slideshow player flash adobe antique unique list click features williamsburg historic mall petite furniture featuring items china coins collectables books stamps welcome virginia restaurant estate triangle dealers sale antiques located lightfoot purchase special colonial hummel exquisite shopper figurines just
Antiqueswilliamsburg.com  ~   Site Info   Whois   Trace Route   RBL Check  
bushwickstudio.com Bushwick Studio - Welcome to Bushwick Studio
bushwickstudio studio bushwick welcome gear artists home links contact directions forward month project record best starting robert work amaze really unbelievable sounding hummel love projects originality klein life room control monitors continue larry send think don far email questions thanks
Bushwickstudio.com  ~   Site Info   Whois   Trace Route   RBL Check  
gentlecurrents.com Gentle Currents Wellness Center
gentlecurrents currents gentle center wellness topbarcontent leftnavframe topbarcontentfarright lic lisa offices link information rothermich ann slidehtml beth click schmitt treats director acupuncture new var massage thursday clinic practitioners practice jan therapy licensed offers services theslide hampshire hummel therapeutic function gentlecurrentswellnesscenter
Gentlecurrents.com  ~   Site Info   Whois   Trace Route   RBL Check  
hardwood101.com Hardwood101.com
hardwood101.com,hardwood floors,flooring,sanding,finishing,sanding and finishing,learn sanding and finishing,sanding equipment,Clarke,Hummel,Somerset,Oshkosh,Lockwood Flooring,Mirage,Homerwood,hardwood installation,learn hardwood,learn sanding and refinishing,learn hardwood installation,tongue and groove,polyurethane,stains,wood flooring,prefinished floor
Hardwood101.com  ~   Site Info   Whois   Trace Route   RBL Check  
goethe-museum.com Goethe-Museum-Düsseldorf
Goethe, Faust, von, Düsseldorf, Museum, Johann, die, der, und, interpreationen, friedrich, goethes, werther, gedichte, schiller, christliche, gretchen, mozart, weimar, lied, jungen, wilhelm, leiden, goethemuseum, goethe-museum, gedicht, carl, neujahrsgedicht, heinrich, wolfgang, werthers, hummel, august, mendelsohn, christian, mann, schubert, karl, könig, deutsche, jacobi, übersetzung, thomas, franz, phaedrus, naturwissenschaftler, abschied, ludwig, beethoven, jägerhof, schloss Jägerhof, jaegerhof
Goethe-museum.com  ~   Site Info   Whois   Trace Route   RBL Check  
repair2restore.com Allan B. Mittelmark - restorationist
Repair and restore, repair 2 restore, Allan B Mittelmark, Allan Mittelmark, Allan B Mittelmark restorationist, repair damaged collectibles, repair figurines, broken collectibles, broken figurines, repair broken glass, repair broken china, repair broken jade, repair broken ivory, restore broken figurines, repair lladro, repair boehm, repair swarovski, repair swarovski crystal, repair hummel, repair royal doulton, restore. Lladro, restore, boehn, restore swarovski, restore, swarovski crystal, restorationist south florida, restorationist Boynton beach, collectible figurines rstorationist, porcelain repair,Repare and restore, repare 2 restore, Allan B Mittelmark, Alan Mittlemark, Allen Mittlemark, Allan B Mittelmark restorationist, repare dammaged collectables, repair figurines, broken collectables, broken figurines, repare broken glass, repare broken china, repare broken jade, repare broken ivory, restore broken figurines, repair lladro, repare boehm, repair swarovski, repare swarovski crystal, repare hummel, repare royal doulton, restore. Lladro, restore, boehm, restore swarovski, restore, swarovski crystal, restorationist south florida, restorationist Boynton beach, collectable figurines rstorationist, porcelain repair, Ceramic repare, porcelain repair, figurines damaged, lladro, Boehm, Kaiser, Geobel, Swarofski crystal, Hummel
Repair2restore.com  ~   Site Info   Whois   Trace Route   RBL Check  
agi32gcc.com LOGIN to get the AGI32 2
agi32gcc agi login home lighting com gcc store customer log contact trainings downloads page gallery update welcome software www diplomatonangrimxlslizzyvendorsspyingtarantulabmxthinningsearchtulumfarewelllogoearls daylighting training calculations renderings electric norwegianwhitmanneurologykillingrulermartenslosemixesdvddefinitongrscholarcssaspartameminervaslidingjohansensadlerinitiativesdectopicscampaignsbogotasmallvilleindicationspubicmadriddisputeaccommodationjimeneziconscookeddecreebrookhavenadaptersmokesdinarheroshitchdirectivescrapbooksmentosmonroevillencllivekanyediecastpersiaellijayrootrappercrabtreerankedsopmaudepetewearesquiretidewaterdistillereldoradopaverfindsgentlemanfadingcodecsacnemotorolahamdenonlineddieimplementsindonesiacommittedtailordecoratingrootquotazoempgmilleflaglertaggedclickswahoosedgwickballardtaoaccreditedgreensburgtaipeibarrymorebarbaramisslecashingweatheringproductionmondejokenataldetroitpouringflordiareceptionistpngdominionretailercopelandwarholhummeltunicacomposephenomenonexplodinglesspaoliamputeehardnessragdollposhhickmanpocketsautomobilesrelevantwarinternshipkimivelocityelectricalbartowtheatricalelbownagelskippingstorieslebanonmayafountainssongbookcoragrahambenninggamblerrittercornedphysicscartierchairscrosstaylorsyellowknifetarahoodyelectronlimbreceptaclecentrifugempeg analysis systems extraordinary program middle east paoli hardness ragdoll amputee phenomenon posh tunica hummel
Agi32gcc.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 150/151« Previous147148149150151Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com