insite - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Insite: 4,082 results found.

bartlettappraisers.com Bartlett & Picarella
bartlettappraisers picarella bartlett firm contact blog links clients home services sale newsletter fees items click facilitation insite site aaa meter work office flexible appraising expertise technical scored criteria ability cost university appraise selection collection city art based certified feesitems member
Bartlettappraisers.com  ~   Site Info   Whois   Trace Route   RBL Check  
gaelicart.com gaelicart.com > gaelicart
gaelicart com visa access paypal conditions terms contact design photographs hosting webworks map generalantrimarmaghcarlowcavanclarecorkderrydonegaldowndublinfermanaghgalwaykerrykildarekilkennylaoisleitrimlimericklongfordlouthmayomeathmonaghanoffalyroscommonsligotipperarytyronewaterfordwest shopping insite artistslogin gaelicartsportartgolfartheritageartabout nameemail website basketenter offers meathwexfordwicklowlondonaction loading special email receive meath offaly monaghan mayo roscommon laois leitrim limerick longford louth wicklow london action
Gaelicart.com  ~   Site Info   Whois   Trace Route   RBL Check  
mk-studio.ru Профессиональное создание веб сайтов, современная система управления сайтом. Услуги по оптимизации и продвижению сайта в сети интернет — Медиа Компас Студио
studio медиа компас студио сайта mk услуги дизайн команда кредо преимущества вакансии сертификаты как сотрудники услуг описание информационная разработка лицензии связаться интернет веб сайтов создание управления система современная сайтом оптимизации профессиональное сети продвижению mks insite статьи работы справочники клиенты студии
Mk-studio.ru  ~   Site Info   Whois   Trace Route   RBL Check  
ortek.co.uk ORTEK : WELCOME TO ORTEK
ortek welcome valid news printing digital technology insite page litho location user presses accessibility plant finishing priority xhtml css distribution workflow web print read divider navigation standards policy compliant variable developments accreditation storage guide awareness studio quality contacts fulfilment company
Ortek.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
trainingwell.com Trainingwell: Corporate Training and Development. Executive Forums, Training Workshops and User Group Meetings
trainingwell services training executive user group client events home contact resources corporate video workshops meetings forums development range upcoming login insite interface clients insights office logo jpg value small showcase presentation page surgery cosmetic learn join need audiences concord sites
Trainingwell.com  ~   Site Info   Whois   Trace Route   RBL Check  
impactretreat.com Impact Retreat 2011 » Welcome
impact, retreat, a&m, university, texas, church, christ, camp, youth, ministries
Impactretreat.com  ~   Site Info   Whois   Trace Route   RBL Check  
iolportal.com IOL Portal : Global e-Invoice Community
iolportal invoice global iol portal community automation accounts invoicing electronic services insite customer direct supplier processing receivable compliant epayment pci enrollment payable workflow transactions tranquil blue eta assoc iapp fusion management invoices survey shared capture discount center service convention industry
Iolportal.com  ~   Site Info   Whois   Trace Route   RBL Check  
foodforlife.ca Food for Life Canada | Home Page
foodforlife food life canada help home page foods refresh donation partners news make contact helps know insite halton good click april need bed woman logo hungry man child bagaco redistribution facilited logistics george founder restaurants stores suppliers tossing landfills mission
Foodforlife.ca  ~   Site Info   Whois   Trace Route   RBL Check  
insitegroup.net Home
insitegroup home project types contact principals service list management integrity site desire ftp group dedication insite consulting engineers construction commissioning controls balancing testing electrical box text engineering services mechanical plumbing
Insitegroup.net  ~   Site Info   Whois   Trace Route   RBL Check  
embarkinteractive.com Embark Interactive
embarkinteractive interactive embark branthaven contact projects careers services com pepsi ford saab new killer tool insite ogilvy published mather design launches january epublsihing latest planets splash branthave screencap music skills super express spring american rsd posts comments driving life break
Embarkinteractive.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 210/242« Previous208209210211212Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com