janesville - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Janesville: 2,486 results found.

rodsconcreteconstruction.com Concrete Contractor Janesville WI - Rod's Concrete & Construction
Rod's Concrete & Construction of Janesville, WI are trusted concrete contractors. Call 608-254-9343 for a free estimate and quality construction work.
Rodsconcreteconstruction.com  ~   Site Info   Whois   Trace Route   RBL Check  
carroll-electric.com Agricultural Electric Janesville, WI - Carroll Electric
Carroll Electric offers expert electrical services for agricultural and commercial needs in Janesville, WI. Specializes in barn upgrades. 608-756-0094
Carroll-electric.com  ~   Site Info   Whois   Trace Route   RBL Check  
emergencytreecarejanesville.com Tree Contractors Janesville, WI ( Wisconsin ) - LP Tree Service
LP Tree Service of Janesville, WI offers professional commercial and residential tree care services at reasonable rates. Call us at 608-352-0960 now.
Emergencytreecarejanesville.com  ~   Site Info   Whois   Trace Route   RBL Check  
janesvillecriminaldefenselawyer.com Law Office Janesville, WI Law Offices of Mason C. Braunschweig
Law Offices of Mason C. Braunschweig provides criminal defense and divorce and family law services. Custody,Placement services to Janesville, WI .Call 608-208-1171.Call now!.
Janesvillecriminaldefenselawyer.com  ~   Site Info   Whois   Trace Route   RBL Check  
alternativehairdesign.net Day spa, beauty salon, hair care services. Janesville, WI
Enjoy precision hair care services and other beauty work from our full-service salon and day spa in Janesville, Wisconsin.
Alternativehairdesign.net  ~   Site Info   Whois   Trace Route   RBL Check  
macspizzashack.com Janesville Pizza Restaurant - Mac's Pizza Shack Janesville, Wisconsin
Mac's Pizza Shack Official Website: Keeping you up to date on what's going on with Mac's Pizza Shack. In addition, check out employment opportunities and weekly specials. We love our customers and Mac's has been employeed owned since 1977
Macspizzashack.com  ~   Site Info   Whois   Trace Route   RBL Check  
thompsonbuildersllc.net General Contractor Janesville, WI - Thompson Builders, LLC
Thompson Builders, LLC Provides General Contractor, New Construction and Remodeling Services to Janesville, WI. Call 608-741-1807 today to get a free estimate.
Thompsonbuildersllc.net  ~   Site Info   Whois   Trace Route   RBL Check  
fixitautomotivellc.com Vehicle Repair Janesville WI ( Wisconsin ) - FixIt Automotive LLC
Fixit Automotive LLC is a licensed and insured repair shop, just starting in the Janesville, WI area. Call 608-563-0866 today.
Fixitautomotivellc.com  ~   Site Info   Whois   Trace Route   RBL Check  
orileyandconways.com Irish Bar Janesville, WI - O'Riley & Conway's Irish Pub
O'Riley & Conway's Irish Pub in Janesville, WI is open 7 days a week, offers daily lunch specials and has 24 beers on tap. Call (608)554-4549.
Orileyandconways.com  ~   Site Info   Whois   Trace Route   RBL Check  
jlradon.com Radon Abatement Janesville, WI - J & L Radon Solutions LLC
J & L Radon Solutions LLC provides residential home inspections, radon testing, detection and mitigation services to the Janesville, WI area. 608-554-1448.
Jlradon.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 11/147« Previous910111213Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com