juliet - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Juliet: 6,130 results found.

tnoralsurgeon.com Oral Surgery Lebanon and Mt Juliet TN, Dental Implants, Wisdom Tooth Removal
Providing Oral Surgery in Lebanon and Mt Juliet TN, Dental Implants, Wisdom Tooth Removal, Dr. Russell Kirk. (615) 453-7800
Tnoralsurgeon.com  ~   Site Info   Whois   Trace Route   RBL Check  
topmountjulietmovers.com Top Mount Juliet Movers Provide Professional Moving Services
Avail Mount Juliet Moving Services from Top Mount Juliet Movers. Get Free Moving Quotes for all kinds of Mount Juliet Moving & Relocation Services.
Topmountjulietmovers.com  ~   Site Info   Whois   Trace Route   RBL Check  
victoryrealtytn.com Billy Studstill - Homes for sale in Green Hills and Mt Juliet
Homes for sale in Mt Juliet
Victoryrealtytn.com  ~   Site Info   Whois   Trace Route   RBL Check  
julietchuadmd.com La Habra Dentist, CA - Dr. Juliet Tan Chua
Dr. Juliet Chua is your general and cosmetic dentist in La Habra, CA. Dedicated to helping people of all ages - kids are welcome!,
Julietchuadmd.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: lahabrafamilydentist.com - lahabrafamilydentistry.com
privatepracticefinancesmadeeasy.com Therapists Private Practice Finances – Counselors Finances – Alternative Health Practitioner business finances
Private Practice Finances Made Easy is a program to help counselors, therapists and alternative health professionals get their business finances organized and create a plan for increasing their income.
Privatepracticefinancesmadeeasy.com  ~   Site Info   Whois   Trace Route   RBL Check  
autoprotn.net AutoSmith Automotive Repair Hendersonville, TN 37075
For tires and automotive service in Mount Juliet, TN see Auto Pro. We are a full service shop and stock tires by Goodyear, Michelin, Uniroyal, Dayton, Firestone and more.
Autoprotn.net  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: autosmithpremium.com - autosmithtn.com - roversamerica.com
greekcuisinegrill.com Greek Cuisine & Grill Restaurant MT. Juliet TN
Joomla! - the dynamic portal engine and content management system
Greekcuisinegrill.com  ~   Site Info   Whois   Trace Route   RBL Check  
julietschapel.com Juliets Wedding Chapel :: Weddings Mt Juliet Tn :: Wedding photography
Each wedding is unique, therefore we tailor our services to meet your needs. We will assist you in your planning and share our referral sources with you.
Julietschapel.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: julietsweddingchapel.com
normandyheightshoa.com Normandy Heights. A residential community in Mt. Juliet, Tennessee
Visit Normandy Heights. A residential community in Mt. Juliet, Tennessee. Browse our neighborhood information and resources in Mt. Juliet, Tennessee. Homeowners Association for Normandy Heights
Normandyheightshoa.com  ~   Site Info   Whois   Trace Route   RBL Check  
airductcleaningwilsoncountytn.com Air Duct Cleaning Mount Juliet, TN - Vortex Air Duct Cleaning
Vortex Air Duct Cleaning specializes in expert air duct cleaning services in the Mount Juliet, TN area. Call 615-828-7655 for more information.
Airductcleaningwilsoncountytn.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 28/325« Previous2627282930Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com