kosovo - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Kosovo: 3,034 results found.

twittarian.org Rotarian directory -Volunteersnest
twittarian district search volunteersnest directory rotarian zone keywords twitter country login account page members republic view rotary israel italy indonesia korea india kosovo kenya japan jamaica ecuador egypt madagascar dominican dominica england finland guatemala guadeloupe germany france honduras peru turkey
Twittarian.org  ~   Site Info   Whois   Trace Route   RBL Check  
amnesti-nu.dk Amnesti Nu
flygtninge , afvist , asylansøger , lommepenge , indsamling , støt , hjælp , motivationsfremmende , foranstaltninger , Dansk Flygtningehjælp , Støttekredsen , Rigspolitiet , kostpengeordning , cafeterieordning , cafeterie-ordning , kantine-ordning , folke , empati , folkeempati , dansk folkeempati.dk , Danmark , konventioner , børnekonvention , børn , asylafviste , børnefamilier , ingenmandsland , torturofre , integration , frivillig , civilsamfund , indignation , Sandholm , Avnstrup , asylsøgere kantineordningen , spisebilletter , madkasseordning , konsekvens , udsendelsesprocedure , Kongelunden , tvangshjemsende , Irak , Kosovo , romaer , Iran , Somalia , udsendelsesposition , kostpenge , amnesti, amnesti nu, udsendelsescenter
Amnesti-nu.dk  ~   Site Info   Whois   Trace Route   RBL Check  
audreyjose.com in His image - Audrey Jose
audreyjose audrey jose image england www church home team info brian leaders albania luton years jonah bible read word key brought date schedule travel theirs friend topic gjilan december grace just speaking invest think kosovo study looked greek love hebrew
Audreyjose.com  ~   Site Info   Whois   Trace Route   RBL Check  
familyaidproject.com Family Aid Project
familyaidproject aid family project response disaster network love local relief help times looks abroad fap missionaries texas perilous like hear mexico rwanda haiti kosovo astrodome night guatemala international ecuador containers india humanitarian sent state efforts outreaches base years famine war
Familyaidproject.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: familyaidproject.org
fap-drn.org Family Aid Project
aid family project response disaster fap drn network love local relief help times looks abroad missionaries texas perilous like hear mexico rwanda haiti kosovo astrodome night guatemala international ecuador containers india humanitarian sent state efforts outreaches base years famine war
Fap-drn.org  ~   Site Info   Whois   Trace Route   RBL Check  
helpingotherstoday.com Helping Others Today
helpingotherstoday today helping fund friendship hot contribute home page friends image fellows white house child children foster clinic books china community teach school camp loeffke initiative organization supports bernard states united kosovo care center ireland income low aiding orphanage sudan
Helpingotherstoday.com  ~   Site Info   Whois   Trace Route   RBL Check  
sms-me-now.com SMS Me NoW - SMS ME NOW
sms account partner drive contact program create test germany france australia canada sweden usa log prices mobile send messages number use cents message internet polynesiafrench mexicomoldovamonaco comoros kosovo west south kuwaitkyrgyzstanlaolatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaumacedoniamadagascarmalawimalaysiamaldivesmalimaltamartiniquemauritaniamauritiusmayotte coastjamaicajapanjerseyjordankazakhstankenyakorea manisraelitalyivory indiesgabongambiageorgiagermanyghanagibraltarglobal satellitegreecegreenlandgrenadaguadeloupeguamguatemalaguernseyguineaguyanahaitihondurashongkonghungaryicelandindiaindonesiairaniraqirelandisle island salvadorequatorial ricacroatiacubacuracaocyprusczech republicdenmarkdjiboutidominicadominican islandscosta
Sms-me-now.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: sms-me-now.net
turkishstates.com Turkish States
turkishstates turkish states turks republic autonomous repuclic living azerbaijan kazakhstan tajikistan uzbekistan northern region cyprus mongolia kyrgyzstan turkey sakha east turkmenistan term balkar kabartay karacay middle circassian west finland ingusetya europe thrace crimea meskhetian gagauz western macedonia kosovo baskurt usa
Turkishstates.com  ~   Site Info   Whois   Trace Route   RBL Check  
paul-watson.net paul-watson.net
Paul Watson, Where War Lives, photojournalist, NPR, Fresh Air Interview, Terry Gross, bestselling author, McClelland and Stewart, journalist, Los Angeles Times, Toronto Star, war correspondent, Pulitzer Prize, Robert Capa Gold Medal, Overseas Press Club of America, William David Cleveland, Mogadishu, Black Hawk, Somalia, Afghanistan, Iraq, Kosovo, Africa, Southeast Asia Bureau Chief, McClelland Stewart, Chapters Online Bestsellers, adventure travel, heroes, Rick Macinnes Rae, Dispatches, Peter Mansbridge, official homepage, blog, ordinary heroes, CBC Sunday Portfolio
Paul-watson.net  ~   Site Info   Whois   Trace Route   RBL Check  
wherewarlives.com wherewarlives.com
Paul Watson, Where War Lives, photojournalist, NPR, Fresh Air Interview, Terry Gross, bestselling author, McClelland and Stewart, journalist, Los Angeles Times, Toronto Star, war correspondent, Pulitzer Prize, Robert Capa Gold Medal, Overseas Press Club of America, William David Cleveland, Mogadishu, Black Hawk, Somalia, Afghanistan, Iraq, Kosovo, Africa, Southeast Asia Bureau Chief, McClelland Stewart, Chapters Online Bestsellers, adventure travel, heroes, Rick Macinnes Rae, Dispatches, Peter Mansbridge, official homepage, blog, ordinary heroes, CBC Sunday Portfolio .
Wherewarlives.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 174/175« Previous171172173174175Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com