lawsuit - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Lawsuit: 21,069 results found.

medicalmalpracticelawyeradvice.com Medical Malpractice Lawyers & Law Firms - Find the Best Medical Malpractice Lawyer to Help Win Your Lawsuit
Find medical malpractice lawyers in your area to assist in your lawsuit. Browse by state and city to find the best medical malpractice lawyer in your area, learn more about medical malpractice laws in your state, and more.
Medicalmalpracticelawyeradvice.com  ~   Site Info   Whois   Trace Route   RBL Check  
civilcourtcases.org Civil Court Cases
Civil court cases including this case about where to file a lawsuit after a plane crash.
Civilcourtcases.org  ~   Site Info   Whois   Trace Route   RBL Check  
homeloanlawsuit.com Home Loan Lawsuits - Unfair Lending & Home Foreclosure
Home Loan Lawsuit - home foreclosure and predatory lending.
Homeloanlawsuit.com  ~   Site Info   Whois   Trace Route   RBL Check  
orcourtsonline.com Oregon Court Records - Criminal, Divorce, Civil, Driving, Domestic ,Lawsuit, Public Records, District Court, Circuit Court
Oregon courts Oregon State Circuit court Oregon Circuit court filings statewide. Oregon criminal records, Oregon civil records, Oregon divorce records, Oregon background check, Oregon courts, employment screening, Oregon felony records, Oregon divorce court
Orcourtsonline.com  ~   Site Info   Whois   Trace Route   RBL Check  
realestatedeception.com Real Estate Deception
Silicon Valley homeowner wins $450,000 in real estate fraud lawsuit!
Realestatedeception.com  ~   Site Info   Whois   Trace Route   RBL Check  
broombobo.com Broome Law Firm, PLLC - Attorneys At Law
Broome Law Firm, PLLC is a trial law firm with experienced lawyers and attorneys who prepare for court and litigation to achieve the best possible outcome for clients through trial, mediation, arbitration and settlement.
Broombobo.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: broomelegal.com
johnsonbryant.com JohnsonBryant- Legal Practitioners
JOHNSON BRYANT is a full service Commercial Law firm with a tradition for excellence in the perfection of its client’s instructions. Our client base is exceptionally diverse due to our extraordinary capacity to tailor our services to meet the specific needs of our client.
Johnsonbryant.com  ~   Site Info   Whois   Trace Route   RBL Check  
myaxeonline.com Myaxe Guitars - Revolutionizing the way you shred
Custom Guitars, Customized Guitars, Custom-built guitars, Les Paul, Epiphone, Gibson, solid-body, guitars, guitar, custom guitar, les paul custom, Myaxe, Floyd Rose, Gibson copies, Gibson copy, Epiphone copy, Epiphone copies, Les Paul copy, Les Paul copies, lawsuit guitar, lawsuit guitars
Myaxeonline.com  ~   Site Info   Whois   Trace Route   RBL Check  
neuropathy.me Neuropathy
Simple Answers About Neuropathy
Neuropathy.me  ~   Site Info   Whois   Trace Route   RBL Check  
stationfireinsuranceclaims.com Soot and Ash Damage to your home resulting from the recent Station Fire and other fires is real and you may be entitled to benefits under your homeowners insurance policy.
Soot and Ash Damage to your home resulting from the recent Station Fire and other fires is real and you may be entitled to benefits under your homeowners insurance policy.
Stationfireinsuranceclaims.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 146/414« Previous144145146147148Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com