locations - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Locations: 379,712 results found.

gerlacswindshieldreplacementshop.com Gerlac's Windshield Replacement Shop Denver CO (303) 731-5467 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Gerlac's Windshield Replacement Shop Denver CO (303) 731-5467, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Gerlacswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
glastianswindshieldreplacementshop.com Glastian's Windshield Replacement Shop Elmhurst IL (630) 478-9774 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Glastian's Windshield Replacement Shop Elmhurst IL (630) 478-9774, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Glastianswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
harveyswindshieldreplacementshop.com Harvey's Windshield Replacement Shop Downers Grove IL (630) 297-4255 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Harvey's Windshield Replacement Shop Downers Grove IL (630) 297-4255, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Harveyswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
kantenswindshieldreplacementshop.com Kanten's Windshield Replacement Shop Schaumburg IL (847) 505-0775 Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Kanten's Windshield Replacement Shop Schaumburg IL (847) 505-0775, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Kantenswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
laszloswindshieldreplacementshop.com Laszlo's Windshield Replacement Shop Silver Spring MD (301) 685-5166 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Laszlo's Windshield Replacement Shop Silver Spring MD (301) 685-5166, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Laszloswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
machanswindshieldreplacementshop.com Machan's Windshield Replacement Shop Beltsville MD (301) 637-4763 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Machan's Windshield Replacement Shop Beltsville MD (301) 637-4763, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Machanswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
magnuswindshieldreplacementshop.com Magnus Windshield Replacement Shop Laurel MD (301) 637-8693 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Magnus Windshield Replacement Shop Laurel MD (301) 637-8693, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Magnuswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
marinaswindshieldreplacementshop.com Marina's Windshield Replacement Shop Concord NC (704) 937-2001 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Marina's Windshield Replacement Shop Concord NC (704) 937-2001, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Marinaswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
mortonswindshieldreplacementshop.com Morton's Windshield Replacement Shop Huntersville NC (704) 826-7347 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Morton's Windshield Replacement Shop Huntersville NC (704) 826-7347, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Mortonswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
nathanswindshieldreplacementshop.com Nathan's Windshield Replacement Shop Charlotte NC (704) 826-7517 - Windshield Replacement, Windshield Repair, Auto Glass Replacement and Repair
Nathan's Windshield Replacement Shop Charlotte NC (704) 826-7517, Windshield Replacement, Windshield Repair, Auto Glass Replacement including Free Mobile Service
Nathanswindshieldreplacementshop.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 97/626« Previous9596979899Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com