loxahatchee - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Loxahatchee: 672 results found.

cocowondergardens.com Coco Wonder Gardens LLC
Welcome to Coco Wonder Gardens LLC
Cocowondergardens.com  ~   Site Info   Whois   Trace Route   RBL Check  
officecleaningservicewestpalm.com West Palm Beach, Fl., Daniela's House and Office Cleaning
Daniela's House and Office Cleaning Services (561)706-6707 include; general cleaning, carpet, tile cleaning, floor waxing and flood water removal. Servicing greater West Palm Beach.
Officecleaningservicewestpalm.com  ~   Site Info   Whois   Trace Route   RBL Check  
nancyjenningsrealtor.com Nancy Jennings Realtor
Nancy Jennings Realtor...I'll work 10 Times Harder for you!!! Proudly serving Wellington, Royal Palm Beach, Royal Palm Beach Acreage, Loxahatchee, West Palm Beach, Greenacres and Lake Worth, Florida
Nancyjenningsrealtor.com  ~   Site Info   Whois   Trace Route   RBL Check  
westpalmbeachtownhomes.com West Palm Beach Town Homes | Find the Best Town Homes in West Palm Beach, FL Today
West Palm Beach Town Homes - Let us help you find the top Town Homes in West Palm Beach, FL. Find addresses, phone numbers, driving directions, reviews and ratings on WestPalmBeachTownHomes.com
Westpalmbeachtownhomes.com  ~   Site Info   Whois   Trace Route   RBL Check  
bodyworksbydan.com Bodyworks By Dan
Massage Therapist located in Royal Palm Beach Florida
Bodyworksbydan.com  ~   Site Info   Whois   Trace Route   RBL Check  
constructiontalk.com SSI Home
Construction Talk is the home of SSI Roofing your one stop source for all of your roofing and general contracting needs including hurricane repair.
Constructiontalk.com  ~   Site Info   Whois   Trace Route   RBL Check  
fuelingpoint.com Pump Security by Wolfman Security
A gas pump security device that is installed into the fuel dispenser to prevent theft and tampering
Fuelingpoint.com  ~   Site Info   Whois   Trace Route   RBL Check  
gladesgasac.com Glades Gas of Belle Glade - Your South Florida Propane Source
Glades Gas offers propane service and gas powered air conditioning and refrigeration, appliances, cookers and smokers to Belle Glade, Pahokee, Loxahatchee, Wellington, Royal Palm and other areas in South Florida.
Gladesgasac.com  ~   Site Info   Whois   Trace Route   RBL Check  
tyzrent2buy.com Free List Of Rent To Own Homes - Stop Paying Rent West Palm Beach, Palm Beach County
Free List Of Rent To Own Homes - Stop Paying Rent West Palm Beach, Palm Beach County: West Palm Beach,Atlantis,Boca Raton,Boynton Beach,Delray Beach,Greenacres,Haverhill,Hypoluxo,Juno Beach,Jupiter,Lake Clarke Shores,Lake Park,Lake Worth,Lantana,Loxahatchee,North Palm Beach,Ocean Ridge,Palm Beach,Palm Beach Gardens,Palm Springs,Riviera Beach,Royal Palm Beach,Tequesta,Wellington
Tyzrent2buy.com  ~   Site Info   Whois   Trace Route   RBL Check  
tyzrent2sell.com Buyers For Your House West Palm Beach, Palm Beach County
Buyers For Your House West Palm Beach, Palm Beach County: West Palm Beach,Atlantis,Boca Raton,Boynton Beach,Delray Beach,Greenacres,Haverhill,Hypoluxo,Juno Beach,Jupiter,Lake Clarke Shores,Lake Park,Lake Worth,Lantana,Loxahatchee,North Palm Beach,Ocean Ridge,Palm Beach,Palm Beach Gardens,Palm Springs,Riviera Beach,Royal Palm Beach,Tequesta,Wellington
Tyzrent2sell.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 23/35« Previous2122232425Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com