middlesbrough - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Middlesbrough: 2,066 results found.

feefifofum.co.uk Fee Fi Fo Fum - Urban Giants Graphic Design & Branding Agency - Design Giants | Brand Giants | Logo Giants | Web Design Giants | PR Giants | Marketing Giants | Creative Giants | Graphic Design Giants
Fee Fi Fo Fum | Urban Giants Design | Graphic Design & Brand Agency | Hartlepool, Durham, Middlebrough, Sunderand, Newcastle, Darlington, Tees Valley and North East England | Beanstalk PR | Design Hartlepool | Design Durham | Design Middlesbrough | Design Sunderland | Design Newcastle
Feefifofum.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
gizmovisual.com Gizmo Visual Studios - Creative Interactive Technology
Multimedia studio driven by a passion for visual creativity and love for technology.
Gizmovisual.com  ~   Site Info   Whois   Trace Route   RBL Check  
joemitchelldesigns.com Octave Up Designs
Octave Up Designs is the Online Portfolio for Joe Mitchell, a freelance Web Designer
Joemitchelldesigns.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: octaveup.co.uk
npc-training.com NPC Training Limited | Construction & Winter Training
NPC Training Ltd provide professional training and assessment services in the fields of construction, highways and winter maintenance. They are training professionals providing a high level of quality service.
Npc-training.com  ~   Site Info   Whois   Trace Route   RBL Check  
parkhotel-redcar.com The Park Hotel
The Park Hotel is situated overlooking the golden coastline of Redcar. The Hotel can be found on the seafront, only five minutes from the railway station and convenient for all of the regions business centres, with easy access to the A1(M),A66,A19, Teesside Park, Middlesbrough and the heart of industrial Teesside.
Parkhotel-redcar.com  ~   Site Info   Whois   Trace Route   RBL Check  
rajbarirestaurant.co.uk Raj Bari
Raj Bari is an Indian restaurant and take away located in Yarm, Teesside.
Rajbarirestaurant.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
teesvalleyemergencyplanning.info Redirecting to Cleveland Emergency Planning
Information regarding the management of major incidents and disasters in the former Cleveland area
Teesvalleyemergencyplanning.info  ~   Site Info   Whois   Trace Route   RBL Check  
uk-conference-venues.co.uk Conference Venues and Conference Centres
Conference venues search of more than 29,000 venues. We offer a free venue search, expert advice and fast proposals for your next conference venue. We specialise in London conference venues and large conference venues.
Uk-conference-venues.co.uk  ~   Site Info   Whois   Trace Route   RBL Check  
cater-king.com cater-king.co.uk quality northeast caterers
Northeast based quality catering company covering all areas in Northeast UK. Hot & Cold Buffets, Business Lunches, Childrens Party Catering. Darlington, Sedgefield, Yarm, Aycliffe, Stockton, Middlesbrough, Barnard Castle, Bishop Auckland, Richmond
Cater-king.com  ~   Site Info   Whois   Trace Route   RBL Check  
davidtarn.com David Tarn Landscape Photographer - Home Page
David Tarn landscape photographer is based in North Yorkshire, England.
Davidtarn.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: davidtarn.co.uk
 


Page 63/112« Previous6162636465Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com