mississippi - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Mississippi: 44,786 results found.

mstaxidermist.com MS Taxidermist Joey Murphey in Chunky Mississippi | MS Taxidermy
MS Taxidermist Joey Murphey. Mississippi Taxidermy. Joey Murphey is a full-service taxidermist with years of experience. Joey Murphey’s taxidermy studio is located twelve miles west of Meridian, MS, just south of US Hwy 80. He has proudly served many clients over the last 30 years from the East-Mississippi area from the cities of Meridian, Collinsville, Philadelphia, Newton, Hickory, Forest, and Bay Springs; and would like to bring this same level of service to wildlife enthusiasts in other areas outside this region.
Mstaxidermist.com  ~   Site Info   Whois   Trace Route   RBL Check  
randkglass.com Glass Services Greenwood, MS ( Mississippi ) - R & K Glass
R & K Glass provides quality glass services to the Greenwood, MS area. Call 662-453-5279.
Randkglass.com  ~   Site Info   Whois   Trace Route   RBL Check  
rebelsignstn.com Sign and Banner Shop Oxford, MS ( Mississippi ) | Rebel Signs
Rebel Signs provides quality signage and banners and complete sign repair and lighting services to the Oxford, MS area. Call 662-513-0840.
Rebelsignstn.com  ~   Site Info   Whois   Trace Route   RBL Check  
biloxibeachhouses.com Furnished beach house and cottage rentals - Mississippi Gulf coast.
Mississippi rentals, beach house, cottages, condos, Gulf Coast Biloxi, golfing
Biloxibeachhouses.com  ~   Site Info   Whois   Trace Route   RBL Check  
happynowfarm.com Upper Mississippi River Estate
Real estate for sale located along the Mississippi River in Northeast Iowa
Happynowfarm.com  ~   Site Info   Whois   Trace Route   RBL Check  
mattperryagencyllc.com Matt Perry Web Site
Insurance in Fulton Mississippi
Mattperryagencyllc.com  ~   Site Info   Whois   Trace Route   RBL Check  
mississippicriminaldefenselawyer-blog.com Mississippi Criminal Defense Lawyer Blog :: Published by Southaven, Mississippi Criminal Defense Lawyer :: The Stroud Law Firm
Published By The Stroud Law Firm
Mississippicriminaldefenselawyer-blog.com  ~   Site Info   Whois   Trace Route   RBL Check  
mississippiheadwaters.org Mississippi Headwaters Board - Protecting the First 400 Miles of the Mississippi River
The Mississippi Headwaters Board (MHB) is a joint powers board of the first eight counties on the Mississippi River. The Mississippi Headwaters board is organized to protect and preserve the natural, cultural, historic, scientific and recreational values of the first 400 miles of the Mississippi River
Mississippiheadwaters.org  ~   Site Info   Whois   Trace Route   RBL Check  
butchoustaletmazda.net Butch Oustalet Mazda in Gulfport, Mississippi
Butch Oustalet Mazda in Gulfport, Mississippi serving Gulfport, Wiggins, Hattiesburg, New Orleans, Biloxi, Mississippi - offering new and used Mazdas in Gulfport, Mississippi
Butchoustaletmazda.net  ~   Site Info   Whois   Trace Route   RBL Check  
extremeexcursionshummer.com Limousine Service Mississippi, Alabama, Louisiana, Tennessee: Extreme Excursions, LLC
Mississippi Limousine Service, EXTREME EXCURSIONS, LLC provides World Class HUMMER H2 Super Stretch Limousine service throughout Mississippi, Alabama, Louisiana, Florida, Tennessee, Georgia
Extremeexcursionshummer.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: extremeexcursions.net - mississippihummer.com - mslimoservice.com - mslimousineservice.com
 


Page 134/605« Previous132133134135136Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com