mylapore - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Mylapore: 143 results found.

dudduradhika.com :: Duddu Radhika ::
dudduradhika radhika duddu concert january arts fine academy cancri powered mylapore hindu music voice south cultural classical impressive indian field sri artistes repertoire schedule wide nungambakkam rights ranging reserved potential holds popular carnatic stage world future thyagaraja young audiences vocalist
Dudduradhika.com  ~   Site Info   Whois   Trace Route   RBL Check  
turakhiaopticians.com ### Welcome to Turakhia ###
turakhiaopticians turakhia welcome lenses nagar contact care enquiry eye repairs glasses frames sun friend refer quality webtechx profile policy perambur powered mylapore anna porur adyar gmail site com opticians gift safty tips vouchers telephone email voucher careers locator book face
Turakhiaopticians.com  ~   Site Info   Whois   Trace Route   RBL Check  
diya.org.in DIYA – Illuminating Lives
diya lives illuminating team mylapore projects center rss contact planting drive tree greetings nizhal home past kaattupalli project velachery library wordpress programmes theme faqs tuition newsletters media arcsin current rsd feed atom comments life gmail com purpose chennai search bank
Diya.org.in  ~   Site Info   Whois   Trace Route   RBL Check  
rightstartacademy.com Welcome to RIGHTSTART ACADEMY
rightstartacademy welcome academy rightstart tel chennai mobile mylapore construction yahoo email high alpha division business enterprise royapettah pvt road
Rightstartacademy.com  ~   Site Info   Whois   Trace Route   RBL Check  
aalamfoundation.org aalam foundation :: Welcomes you
aalamfoundation aalam foundation welcomes org www india mail info website chennai jumbulingam soon updating sonstruction foundationshanthi apartments road judge mylapore
Aalamfoundation.org  ~   Site Info   Whois   Trace Route   RBL Check  
eraithirai.com ERAITHIRAI இறைதிரை
eraithirai இறைதிரை video edit post temple chennai page web hit counter photo mylapore permanent email link temples comments tamil madaipalli sri kapaleeswarar atom festival murugan lyrics thiru panguni mcarnan posts march amman anjaneyar thaer garuda pongal month nandhi adhigara posted
Eraithirai.com  ~   Site Info   Whois   Trace Route   RBL Check  
etapowergen.com Untitled Document
etapowergen untitled document radhakrishnan floor salai chennai shortly shall centre mylapore gen coming construction site soon contact power eta city
Etapowergen.com  ~   Site Info   Whois   Trace Route   RBL Check  
jsemployment.com jsemployment
jsemployment com www visit near jobs kalyani hospital beach chennai mylapore regd agencies employment sreenivasan manager radhakrishnan cell road
Jsemployment.com  ~   Site Info   Whois   Trace Route   RBL Check  
newedges.com Properties For Builders
newedges builders properties builder click login nagar register home residental rent house pondicherry mylapore apartment floor hampi buy suggest future contact city post select guest document untitled ghgfhfgfdgdfgdfggfhgfhhfghghgfhbbvjyiuiuihj requirement project state sdfsf nicobar pradeshmaharashtramanipurmeghalayamizoramnagalandorissapondicherrypunjabrajasthansikkimtamilnadutripurauttar kashmirjharkhandkarnatakakeralalakshadweepmadhya pradeshuttaranchalwest bengal welcome pradeshjammu diudelhigoagujaratharyanahimachal
Newedges.com  ~   Site Info   Whois   Trace Route   RBL Check  
dodlaengineering.com Website Design from www.dodlaengineering.com
dodlaengineering design mail com contacts erp www website chennai west mylapore avenue construction bishop phone email wallers
Dodlaengineering.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 6/10« Previous45678Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com