nih - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Nih: 3,173 results found.

nanomedcenter.org Nanomedicine - Funded Research
nanomedcenter nanomedicine research funded center progress exit disclaimer report reports archived website description goals health news logo link national implementation members science meetings group funding common home fund control institutes usa gov printer services planning human department nih awards overview
Nanomedcenter.org  ~   Site Info   Whois   Trace Route   RBL Check  
neuroportraits.eu Introduction | Portraits of European Neuroscientists
neuroportraits portraits introduction european neuroscientists www neuroscience org portrait dawning feedback subjects contact books archive nlm gov nih uni edu search science site home list thumbnail send image terms wish licensing enter view brain historical bium faculty lab univ washington
Neuroportraits.eu  ~   Site Info   Whois   Trace Route   RBL Check  
prairieviewemergencyservices.com WELCOME TO PRAIRIE VIEW EMERGENCY SERVICES
prairieviewemergencyservices emergency prairie view services welcome click com http forecast www gov state html weather service data university tceg toxnet nim dps nih national management noaa hurricane ozone network info information exec forms nav comm pubs hgx bin srh social
Prairieviewemergencyservices.com  ~   Site Info   Whois   Trace Route   RBL Check  
sadofne.com Sleep Apnea Dentist. Dentists play an important role in the team approach to the treatment of obstructive sleep apnea.
sadofne demko denist sleep apnea dentists treatment obstructive play approach important role team dentist appliance oral nhlbi effects overview medicare support www background nih gov blue medical information dental provider therapy physicians billing patient click indiana complete covered labs sequelae
Sadofne.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: sadofne.org
sleepapneadentist.com Sleep Apnea Dentist. Dentists play an important role in the team approach to the treatment of obstructive sleep apnea.
sleepapneadentist demko denist sleep apnea dentists treatment obstructive play approach important role team dentist appliance oral nhlbi effects overview medicare support www background nih gov blue medical information dental provider therapy physicians billing patient click indiana complete covered labs sequelae
Sleepapneadentist.com  ~   Site Info   Whois   Trace Route   RBL Check  
sleepapneadentistofmass.com Sleep Apnea Dentist. Dentists play an important role in the team approach to the treatment of obstructive sleep apnea.
sleepapneadentistofmass demko denist sleep apnea dentists treatment obstructive play approach important role team dentist appliance oral nhlbi effects overview medicare support www background nih gov blue medical information dental provider therapy physicians billing patient click indiana complete covered labs sequelae
Sleepapneadentistofmass.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: sleepapneadentistofmass.org
sleepapneadentistofne.com Sleep Apnea Dentist. Dentists play an important role in the team approach to the treatment of obstructive sleep apnea.
sleepapneadentistofne demko denist sleep apnea dentists treatment obstructive play approach important role team dentist appliance oral nhlbi effects overview medicare support www background nih gov blue medical information dental provider therapy physicians billing patient click indiana complete covered labs sequelae
Sleepapneadentistofne.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: sleepapneadentistofne.org
sleepapneadentistofnewengland.com Sleep Apnea Dentist. Dentists play an important role in the team approach to the treatment of obstructive sleep apnea.
sleepapneadentistofnewengland demko denist sleep apnea dentists treatment obstructive play approach important role team dentist appliance oral nhlbi effects overview medicare support www background nih gov blue medical information dental provider therapy physicians billing patient click indiana complete covered labs sequelae
Sleepapneadentistofnewengland.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: sleepapneadentistofnewengland.org
sleepapneadentistsofmassachusetts.com Sleep Apnea Dentist. Dentists play an important role in the team approach to the treatment of obstructive sleep apnea.
sleepapneadentistsofmassachusetts demko denist sleep apnea dentists treatment obstructive play approach important role team dentist appliance oral nhlbi effects overview medicare support www background nih gov blue medical information dental provider therapy physicians billing patient click indiana complete covered labs sequelae
Sleepapneadentistsofmassachusetts.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: sleepapneadentistsofmassachusetts.org
sleepapneadentistsofnewengland.com Sleep Apnea Dentist. Dentists play an important role in the team approach to the treatment of obstructive sleep apnea.
sleepapneadentistsofnewengland demko denist sleep apnea dentists treatment obstructive play approach important role team dentist appliance oral nhlbi effects overview medicare support www background nih gov blue medical information dental provider therapy physicians billing patient click indiana complete covered labs sequelae
Sleepapneadentistsofnewengland.com  ~   Site Info   Whois   Trace Route   RBL Check  
Similar Sites: sleepapneadentistsofnewengland.org
 


Page 122/172« Previous120121122123124Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com