Nominations

Nominations: 5,567 results found.

American Association on Intellectual and Developmental Disabilities
msaaidd award cotten disabilities developmental intellectual paul association american annual conference news home bylaws officers links manual operations pictures page aamr change field mississippi persons care fellows services organization treatment leadership professional training study chapter miller members nominations based membership
Msaaidd.org ~ Site Info Whois Trace Route RBL Check

NHHPCO
nhhpco membership consider opioid guidelines individual use care click new hospice palliative board hampshire conference directors info april details join state committee fall annual download newsletter tuesday save information program available news healthcare member networking pain initiative providers nomination nominations
Nhhpco.org ~ Site Info Whois Trace Route RBL Check

Nicole Sylvester Films
nicolesylvesterfilms nicole films sylvester camera stop contact sample home reel work film festival detroit award member cable feature york new news documentary morning short american television international production pbs played cinema received projects block mike women nominations black directorial second
Nicolesylvesterfilms.com ~ Site Info Whois Trace Route RBL Check

Speedway City Home Of The Sprintcar Nationals
speedwaycity speedway city sprintcar home nationals april track march november january night february derby easter championship december october round july points sunday super september final caravan dunny august lap meeting june open entry sprintcars jamie sedan pit shane admission nominations
Speedwaycity.com.au ~ Site Info Whois Trace Route RBL Check

TackAndApparel.com English Riding Tack and Apparel Everything for Horse and Rider
tackandapparel sale horses complexitysallerockvillesashnominationshuangcatebargelimcannedgammaconsulatehermitppppoliciesshimanoliposuctionretrieverobbiegaloosingbroadcasterstratfordsudanchungconcoursspotssaloonaddedpentagramwineryeulesswhitrequestingimaxfibroiddownhillbuffaloreplacedrockiesshowcaseawbakerseulesscarbondalelemansivybirdmangopfallacybouncyareassdkdandyeverlastingcelebrationshandlercleaningillegalvincentbattlefield capitalcontaminationsteelydaftsupergirlromanohismokernorthvillebuyreplacedumbilicalelevationgarnetchaplainspitfireluvfuturefrightskidoologitechamericanszumhoesbelvideregreystonefollowosterfarrahpicspcmawggoinglengthasapinhalersourcestorquaymusiciansgasketsphiclawsymcateekoenigdoodlelovetttetonlabradoodleboilersignificadooptometryshipperppmmunoztrillionmuddjodiespeerflanaganjunecrowleyantwebpageswitnesscurranyugoslaviaoperatorsyoungestsewerbandedstakesdogpilecfpennysaverstuarttreatingvaleriecleburnewengerlifespantriopropelleremployershimselfwalkedtrancev cviceconditionersfactsmeteoriteferndalepoconoslossesdocumentationcheatshazerayoscommercewasillaschoopostcodecratesmarrowjanellehostageinframemorialbaylinerdevonshirel horse com english riding rider apparel tack replaced euless rockville nominations sash bayliner huang memorial devonshire complexity salle consulate hermit ppp policies infra gamma barge lim canned cate oscommerce poconos losses documentation ferndale meteorite
Tackandapparel.com ~ Site Info Whois Trace Route RBL Check

Tom Smith Foundation, Inc.
tomsmithfoundation tom smith foundation mail click information scholarship westwood youths college boston year like golf contact written scholarships donations high box walpole read school article memorial tournament newspaper learn tsf nominations accepting winner make past pictures tournaments new events upcoming
Tomsmithfoundation.com ~ Site Info Whois Trace Route RBL Check

TONEWAVES - Designing Sound
tonewaves sound designing film work festival home london budget best micro feature services liff contact independent design award bullets official short mpse lost nominations born oscars news delighted excited ghose confession team deadlines meeting copyright manage handle country wins concept
Tonewaves.com ~ Site Info Whois Trace Route RBL Check

Viluthu
viluthu read women public political candidates parties contact documents publications stories archives activities com success bnzones march district trincomalee education local government jaffna meetings rights voting events lanka sri participating course held skills change article elections training nominations irukkiram voters
Viluthu.org ~ Site Info Whois Trace Route RBL Check

Bill Monroe Stamp Campaign
billmonroestamp monroe campaign stamp grassware guidelines home guestbook faq links help committee year postage letter considers commemorative postal service musical citizens september approximately issuance years united like states music write country appreciated worldwide nominations usa recognition outside details work sent
Billmonroestamp.org ~ Site Info Whois Trace Route RBL Check

Home Page
bridgestudioforperformingarts home page web companies hosting registration com classes teachers upcoming policies domain www photos howardmcgillin bridge world broadway howard studio phantom performance new desk know drama mcgillin award performer scenes industry york nominations nominated creative opportunity park tony theatre
Bridgestudioforperformingarts.com ~ Site Info Whois Trace Route RBL Check