obtain - Search results :.  Site Info   Whois   Traceroute   RBL Check  

Enter Web Site URL Address:
 

Obtain: 39,383 results found.

workoutstoincreaseverticaljump.com Workouts To Increase Verticle Jump
Discover how you too can obtain the secret workouts to increase vertical jump
Workoutstoincreaseverticaljump.com  ~   Site Info   Whois   Trace Route   RBL Check  
worldclassaps.com Advanced planning and scheduling
Obtain improved manufacturing performance with market leading APS (advanced planning scheduling) tools.
Worldclassaps.com  ~   Site Info   Whois   Trace Route   RBL Check  
xdriveonlinestorage.com Online Storage - Xdrive
Obtain online storage to back up your valuable files. Protect your files with Xdrive
Xdriveonlinestorage.com  ~   Site Info   Whois   Trace Route   RBL Check  
yorktennisbookings.com York Parks and Recreation
Online tennis reservation system allows players to reserve courts
Yorktennisbookings.com  ~   Site Info   Whois   Trace Route   RBL Check  
alabamacriminaldefenseattorney.com Alabama Criminal Defense Attorney.com
Criminal Defense Attorney.com Lawyers in Alabama
Alabamacriminaldefenseattorney.com  ~   Site Info   Whois   Trace Route   RBL Check  
alaskacriminaldefenselawyers.com Alaska Criminal Defense Lawyers.com
Criminal Defense Lawyers.com Lawyers in Alaska
Alaskacriminaldefenselawyers.com  ~   Site Info   Whois   Trace Route   RBL Check  
allentowncriminaldefenseattorney.com Allen Town Criminal Defense Attorney.com
Criminal Defense Attorney.com Lawyers in Allentown
Allentowncriminaldefenseattorney.com  ~   Site Info   Whois   Trace Route   RBL Check  
amarillocriminaldefenseattorney.com Amarillo Criminal Defense Attorney.com
Criminal Defense Attorney.com Lawyers in Amarillo
Amarillocriminaldefenseattorney.com  ~   Site Info   Whois   Trace Route   RBL Check  
arizonacriminaldefenseattorneys.com Arizona Criminal Defense Attorneys.com
Criminal Defense Attorneys.com Lawyers in Arizona
Arizonacriminaldefenseattorneys.com  ~   Site Info   Whois   Trace Route   RBL Check  
arlingtoncriminaldefenseattorney.com Arlington Criminal Defense Attorney.com
Criminal Defense Attorney.com Lawyers in Arlington
Arlingtoncriminaldefenseattorney.com  ~   Site Info   Whois   Trace Route   RBL Check  
 


Page 235/535« Previous233234235236237Next »
  IP Index    TLD Index    Domain Index    Site Index      Copyright © 2013 dawhois.com